| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341730.1 | 3prime_partial | 149 | 250-696(+) |
Amino Acid sequence : | |||
| MLSITSTRATPALSLDQVARNQAAGRAEAMVERASTDLAVGGLTTVNPVGMGGGTNRSKPIRMDLVDMGGSLNLSMADLVMEGGLSRRSMDLVDMGGGRSRRNMDLVVDMEGDLSRRSMD LVVDMEGSLTRRNMDPVDMEGGRSLTNMD | |||
Physicochemical properties | |||
| Number of amino acids: | 149 | ||
| Molecular weight: | 14,108.795 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
| Instability index: | 90.848 | ||
| aromaticity | 0.039 | ||
| GRAVY | 0.277 | ||
Secondary Structure Fraction | |||
| Helix | 0.344 | ||
| turn | 0.328 | ||
| sheet | 0.203 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341730.1 | 5prime_partial | 137 | 3-416(+) |
Amino Acid sequence : | |||
| KKNQSTMSLFPKGHHDSADEVDDFDEYDPTPYGGGYNIELTYGRPLPPSEEICYPNASSANDDFDYDRPQYSSSAEPSAYADDALDNEYKSYARPKPRPGRPQSGGRSGGGYGGESEYGS GGGRTDYGESGGYGRRH* | |||
Physicochemical properties | |||
| Number of amino acids: | 137 | ||
| Molecular weight: | 14,108.795 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
| Instability index: | 90.848 | ||
| aromaticity | 0.039 | ||
| GRAVY | 0.277 | ||
Secondary Structure Fraction | |||
| Helix | 0.344 | ||
| turn | 0.328 | ||
| sheet | 0.203 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341730.1 | 5prime_partial | 136 | 696-286(-) |
Amino Acid sequence : | |||
| IHIRQTPASFHIHRIHIPPSQASFHIHHQIHTPPTQVSFHIHHQIHIPPTPASSHIHQIHAPPTQASFHNQIRHTQIQASSHIHQIHTNRFAPISASAHTHRIHRSQSSHRQIRTRSLHH SLRPTCRLIAGDLVEA* | |||
Physicochemical properties | |||
| Number of amino acids: | 136 | ||
| Molecular weight: | 14,108.795 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
| Instability index: | 90.848 | ||
| aromaticity | 0.039 | ||
| GRAVY | 0.277 | ||
Secondary Structure Fraction | |||
| Helix | 0.344 | ||
| turn | 0.328 | ||
| sheet | 0.203 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341730.1 | 5prime_partial | 128 | 698-312(-) |
Amino Acid sequence : | |||
| RSIFVRLRPPSISTGSIFLRVRLPSISTTRSILLRLRSPSISTTRSIFLRLRPPPISTRSMLLRLRPPSITRSAILRFRLPPISTRSIRIGLLRLVPPPIPTGFTVVSPPTARSVLALST IASARPAA* | |||
Physicochemical properties | |||
| Number of amino acids: | 128 | ||
| Molecular weight: | 14,108.795 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
| Instability index: | 90.848 | ||
| aromaticity | 0.039 | ||
| GRAVY | 0.277 | ||
Secondary Structure Fraction | |||
| Helix | 0.344 | ||
| turn | 0.328 | ||
| sheet | 0.203 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341730.1 | 3prime_partial | 149 | 250-696(+) |
Amino Acid sequence : | |||
| MLSITSTRATPALSLDQVARNQAAGRAEAMVERASTDLAVGGLTTVNPVGMGGGTNRSKPIRMDLVDMGGSLNLSMADLVMEGGLSRRSMDLVDMGGGRSRRNMDLVVDMEGDLSRRSMD LVVDMEGSLTRRNMDPVDMEGGRSLTNMD | |||
Physicochemical properties | |||
| Number of amino acids: | 149 | ||
| Molecular weight: | 14,108.795 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
| Instability index: | 90.848 | ||
| aromaticity | 0.039 | ||
| GRAVY | 0.277 | ||
Secondary Structure Fraction | |||
| Helix | 0.344 | ||
| turn | 0.328 | ||
| sheet | 0.203 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341730.1 | 5prime_partial | 137 | 3-416(+) |
Amino Acid sequence : | |||
| KKNQSTMSLFPKGHHDSADEVDDFDEYDPTPYGGGYNIELTYGRPLPPSEEICYPNASSANDDFDYDRPQYSSSAEPSAYADDALDNEYKSYARPKPRPGRPQSGGRSGGGYGGESEYGS GGGRTDYGESGGYGRRH* | |||
Physicochemical properties | |||
| Number of amino acids: | 137 | ||
| Molecular weight: | 14,108.795 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
| Instability index: | 90.848 | ||
| aromaticity | 0.039 | ||
| GRAVY | 0.277 | ||
Secondary Structure Fraction | |||
| Helix | 0.344 | ||
| turn | 0.328 | ||
| sheet | 0.203 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341730.1 | 5prime_partial | 136 | 696-286(-) |
Amino Acid sequence : | |||
| IHIRQTPASFHIHRIHIPPSQASFHIHHQIHTPPTQVSFHIHHQIHIPPTPASSHIHQIHAPPTQASFHNQIRHTQIQASSHIHQIHTNRFAPISASAHTHRIHRSQSSHRQIRTRSLHH SLRPTCRLIAGDLVEA* | |||
Physicochemical properties | |||
| Number of amino acids: | 136 | ||
| Molecular weight: | 14,108.795 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
| Instability index: | 90.848 | ||
| aromaticity | 0.039 | ||
| GRAVY | 0.277 | ||
Secondary Structure Fraction | |||
| Helix | 0.344 | ||
| turn | 0.328 | ||
| sheet | 0.203 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341730.1 | 5prime_partial | 128 | 698-312(-) |
Amino Acid sequence : | |||
| RSIFVRLRPPSISTGSIFLRVRLPSISTTRSILLRLRSPSISTTRSIFLRLRPPPISTRSMLLRLRPPSITRSAILRFRLPPISTRSIRIGLLRLVPPPIPTGFTVVSPPTARSVLALST IASARPAA* | |||
Physicochemical properties | |||
| Number of amino acids: | 128 | ||
| Molecular weight: | 14,108.795 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
| Instability index: | 90.848 | ||
| aromaticity | 0.039 | ||
| GRAVY | 0.277 | ||
Secondary Structure Fraction | |||
| Helix | 0.344 | ||
| turn | 0.328 | ||
| sheet | 0.203 | ||