| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341739.1 | internal | 192 | 577-2(-) |
Amino Acid sequence : | |||
| QKCVDATLGILRACMDSKTVKKVVYTSSISTVAVKEKLPDLLDEDVWSDVDFARKLGFTGSSYCISKTVPERAALEFADKPSLDLVSVVPSFIHGPFVCPNLPGSVWSAQALFLGNETHI KYQQITPLVPVDDVASAPIPLFEHLEAKGRYICNAVEVEFDDLSEFLKTRYPQLTCRIQSLFWINPLKAKEF | |||
Physicochemical properties | |||
| Number of amino acids: | 192 | ||
| Molecular weight: | 21,385.436 | ||
| Theoretical pI: | 5.410 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23950 24325 | ||
| Instability index: | 29.029 | ||
| aromaticity | 0.099 | ||
| GRAVY | 0.057 | ||
Secondary Structure Fraction | |||
| Helix | 0.354 | ||
| turn | 0.208 | ||
| sheet | 0.240 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341739.1 | internal | 192 | 577-2(-) |
Amino Acid sequence : | |||
| QKCVDATLGILRACMDSKTVKKVVYTSSISTVAVKEKLPDLLDEDVWSDVDFARKLGFTGSSYCISKTVPERAALEFADKPSLDLVSVVPSFIHGPFVCPNLPGSVWSAQALFLGNETHI KYQQITPLVPVDDVASAPIPLFEHLEAKGRYICNAVEVEFDDLSEFLKTRYPQLTCRIQSLFWINPLKAKEF | |||
Physicochemical properties | |||
| Number of amino acids: | 192 | ||
| Molecular weight: | 21,385.436 | ||
| Theoretical pI: | 5.410 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23950 24325 | ||
| Instability index: | 29.029 | ||
| aromaticity | 0.099 | ||
| GRAVY | 0.057 | ||
Secondary Structure Fraction | |||
| Helix | 0.354 | ||
| turn | 0.208 | ||
| sheet | 0.240 | ||