| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341740.1 | internal | 215 | 646-2(-) |
Amino Acid sequence : | |||
| AAEFSAIRSRLPPHLRRCSTFELLTACLWRCRTIAISPEPNEEVRILCIVNCRKRFNPPIPNGYYGNAFAFPVAISTAGELSRNPLHYAVELVKKAKADVTEEYMKSLADLMVIRGRPHF TVVRSYLVSDVTHAGFGEVDFGWGKPAYGGPAKGGVGAIPGVASFYIPFKNNKGENGVVVPVCLQANAMEVFVRELEGMLKEGGGEAVAYRKTAV | |||
Physicochemical properties | |||
| Number of amino acids: | 215 | ||
| Molecular weight: | 24,360.290 | ||
| Theoretical pI: | 11.304 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1615 | ||
| Instability index: | 58.631 | ||
| aromaticity | 0.051 | ||
| GRAVY | -0.602 | ||
Secondary Structure Fraction | |||
| Helix | 0.242 | ||
| turn | 0.195 | ||
| sheet | 0.274 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341740.1 | internal | 215 | 2-646(+) |
Amino Acid sequence : | |||
| HRCFPVSHRFAAAFFQHPLQLPHKHFHRICLQANRNHYSVLTLVILKRNVKARHTGNSTDAALRRTSVRRLSPAEIHLSEARVRHIRHQVASHHREMRPASNHHQIRQRFHILLRHIGFR LLHQLHRVMQRISRQFAGRGNRDGEGEGIAVVAVGDRRIESLPTIHDAEDPDLFVRLRRDGDGAAAPEARGEELEGGAAAEMGRQAAADGGEFGS | |||
Physicochemical properties | |||
| Number of amino acids: | 215 | ||
| Molecular weight: | 24,360.290 | ||
| Theoretical pI: | 11.304 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1615 | ||
| Instability index: | 58.631 | ||
| aromaticity | 0.051 | ||
| GRAVY | -0.602 | ||
Secondary Structure Fraction | |||
| Helix | 0.242 | ||
| turn | 0.195 | ||
| sheet | 0.274 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341740.1 | internal | 215 | 646-2(-) |
Amino Acid sequence : | |||
| AAEFSAIRSRLPPHLRRCSTFELLTACLWRCRTIAISPEPNEEVRILCIVNCRKRFNPPIPNGYYGNAFAFPVAISTAGELSRNPLHYAVELVKKAKADVTEEYMKSLADLMVIRGRPHF TVVRSYLVSDVTHAGFGEVDFGWGKPAYGGPAKGGVGAIPGVASFYIPFKNNKGENGVVVPVCLQANAMEVFVRELEGMLKEGGGEAVAYRKTAV | |||
Physicochemical properties | |||
| Number of amino acids: | 215 | ||
| Molecular weight: | 24,360.290 | ||
| Theoretical pI: | 11.304 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1615 | ||
| Instability index: | 58.631 | ||
| aromaticity | 0.051 | ||
| GRAVY | -0.602 | ||
Secondary Structure Fraction | |||
| Helix | 0.242 | ||
| turn | 0.195 | ||
| sheet | 0.274 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341740.1 | internal | 215 | 2-646(+) |
Amino Acid sequence : | |||
| HRCFPVSHRFAAAFFQHPLQLPHKHFHRICLQANRNHYSVLTLVILKRNVKARHTGNSTDAALRRTSVRRLSPAEIHLSEARVRHIRHQVASHHREMRPASNHHQIRQRFHILLRHIGFR LLHQLHRVMQRISRQFAGRGNRDGEGEGIAVVAVGDRRIESLPTIHDAEDPDLFVRLRRDGDGAAAPEARGEELEGGAAAEMGRQAAADGGEFGS | |||
Physicochemical properties | |||
| Number of amino acids: | 215 | ||
| Molecular weight: | 24,360.290 | ||
| Theoretical pI: | 11.304 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1615 | ||
| Instability index: | 58.631 | ||
| aromaticity | 0.051 | ||
| GRAVY | -0.602 | ||
Secondary Structure Fraction | |||
| Helix | 0.242 | ||
| turn | 0.195 | ||
| sheet | 0.274 | ||