| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341775.1 | complete | 190 | 121-693(+) |
Amino Acid sequence : | |||
| MEGVAGGEGPSSAATALNQAWRLFQFYLDKSTPHATYRWIGTFLLVSLYALRVYYLQGFYIVTYGLGIYILNLLIGFLSPLVDPEVEGPVLPTKGSDEFKPFIRRLPEFKFWYAVTKALC IAFVMTFFSMFDVPVFWPILLFYWFVLFVLTMKRQIAHMIKYQYLPFNIGKQKYKGKKPAGGSSSSPRGD* | |||
Physicochemical properties | |||
| Number of amino acids: | 190 | ||
| Molecular weight: | 21,764.360 | ||
| Theoretical pI: | 9.519 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 46870 46870 | ||
| Instability index: | 45.812 | ||
| aromaticity | 0.189 | ||
| GRAVY | 0.281 | ||
Secondary Structure Fraction | |||
| Helix | 0.432 | ||
| turn | 0.226 | ||
| sheet | 0.237 | ||