| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341783.1 | 3prime_partial | 197 | 187-777(+) |
Amino Acid sequence : | |||
| MKIIRDRGANSNGKRPGFSTDKSETVELKWTPKSQESRKHQKQLPSLQSMCLSILSENADAITSLDFVPDALRHKICWFLCDSRRMNSHFLELLVNGNPTEVRVRDCSWLSEEQFDKIFK GCNTNKLTVLQLDQGGACIPDYTLCSTLARSPNNLPALTMISLKGAYRLSDAGLNVLASAAPCLKSIDASQCPLLTS | |||
Physicochemical properties | |||
| Number of amino acids: | 197 | ||
| Molecular weight: | 21,819.831 | ||
| Theoretical pI: | 8.580 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19480 19980 | ||
| Instability index: | 43.712 | ||
| aromaticity | 0.056 | ||
| GRAVY | -0.292 | ||
Secondary Structure Fraction | |||
| Helix | 0.269 | ||
| turn | 0.264 | ||
| sheet | 0.259 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341783.1 | 3prime_partial | 197 | 187-777(+) |
Amino Acid sequence : | |||
| MKIIRDRGANSNGKRPGFSTDKSETVELKWTPKSQESRKHQKQLPSLQSMCLSILSENADAITSLDFVPDALRHKICWFLCDSRRMNSHFLELLVNGNPTEVRVRDCSWLSEEQFDKIFK GCNTNKLTVLQLDQGGACIPDYTLCSTLARSPNNLPALTMISLKGAYRLSDAGLNVLASAAPCLKSIDASQCPLLTS | |||
Physicochemical properties | |||
| Number of amino acids: | 197 | ||
| Molecular weight: | 21,819.831 | ||
| Theoretical pI: | 8.580 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19480 19980 | ||
| Instability index: | 43.712 | ||
| aromaticity | 0.056 | ||
| GRAVY | -0.292 | ||
Secondary Structure Fraction | |||
| Helix | 0.269 | ||
| turn | 0.264 | ||
| sheet | 0.259 | ||