| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341784.1 | 5prime_partial | 198 | 745-149(-) |
Amino Acid sequence : | |||
| VCDDFVAAFVFAHASIKDLCLADCMELTDSSLKVIGETCFDLRAIDLRNLCKLTDISILYLANGCQAIQTLKLCRNAFSDDAIAAYLDVCGASFKCLMLNNVIQVSNHTAFFFARNCKNI RSLDLSWCRNLRDEALGLIVDSCELLEVLKLFGCTQVTNVFVDGHSNAQVKLIGLKMTPIFKHIDVPDFLVGPLRYLS* | |||
Physicochemical properties | |||
| Number of amino acids: | 198 | ||
| Molecular weight: | 17,221.541 | ||
| Theoretical pI: | 10.140 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16960 17210 | ||
| Instability index: | 58.816 | ||
| aromaticity | 0.093 | ||
| GRAVY | -0.378 | ||
Secondary Structure Fraction | |||
| Helix | 0.285 | ||
| turn | 0.278 | ||
| sheet | 0.192 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341784.1 | complete | 151 | 87-542(+) |
Amino Acid sequence : | |||
| MVLSNNIRMSNKREIRDHYYNQDRYRSGPTRKSGTSICLNIGVIFNPISFTCAFECPSTKTFVTCVHPNNLSTSSNSHESTMSPSASSLKLRHHDRSKLRIFLQFLAKKKAVWFETWITL LSIKHLKDAPQTSRYAAIASSLNALRHNFSV* | |||
Physicochemical properties | |||
| Number of amino acids: | 151 | ||
| Molecular weight: | 17,221.541 | ||
| Theoretical pI: | 10.140 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16960 17210 | ||
| Instability index: | 58.816 | ||
| aromaticity | 0.093 | ||
| GRAVY | -0.378 | ||
Secondary Structure Fraction | |||
| Helix | 0.285 | ||
| turn | 0.278 | ||
| sheet | 0.192 | ||