| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341785.1 | 3prime_partial | 237 | 59-769(+) |
Amino Acid sequence : | |||
| MDPYKYRPSSAFNSPFMTTNSGAPVWNNNNSLTVGNRGPILLEDYHLVEKLANFDRERIPERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHSLKPNPKSHIQENWRILDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLVNKAGKAYYVKFHWKPTCGVKSLLE | |||
Physicochemical properties | |||
| Number of amino acids: | 237 | ||
| Molecular weight: | 27,156.489 | ||
| Theoretical pI: | 8.486 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 28420 28545 | ||
| Instability index: | 25.723 | ||
| aromaticity | 0.131 | ||
| GRAVY | -0.412 | ||
Secondary Structure Fraction | |||
| Helix | 0.316 | ||
| turn | 0.270 | ||
| sheet | 0.190 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341785.1 | 3prime_partial | 237 | 59-769(+) |
Amino Acid sequence : | |||
| MDPYKYRPSSAFNSPFMTTNSGAPVWNNNNSLTVGNRGPILLEDYHLVEKLANFDRERIPERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHSLKPNPKSHIQENWRILDFFSHHPESLHMFTFLFDDIGIPQDYRHMEGSGVNTYTLVNKAGKAYYVKFHWKPTCGVKSLLE | |||
Physicochemical properties | |||
| Number of amino acids: | 237 | ||
| Molecular weight: | 27,156.489 | ||
| Theoretical pI: | 8.486 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 28420 28545 | ||
| Instability index: | 25.723 | ||
| aromaticity | 0.131 | ||
| GRAVY | -0.412 | ||
Secondary Structure Fraction | |||
| Helix | 0.316 | ||
| turn | 0.270 | ||
| sheet | 0.190 | ||