| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341790.1 | 5prime_partial | 223 | 750-79(-) |
Amino Acid sequence : | |||
| TFRQSGGAGGEGQRNGVVWIDLNLRRLRLVGFREGREMQASLRRGVDGEDGEILTEDEGVIACVPELADVLGLRDDDLGVGGVELLEDLFGGAERVGGGGDGADHGSSHESEDEFGAVLE QHHDDVASLESEVGEAGGDFAADEVRLGKGVGFARIAGDEAWAVGELGEVLEAVCVEREVVGDGNGGEFGDKNMSFLGGLSLGESMRGKLGILSFGSRHRQHC* | |||
Physicochemical properties | |||
| Number of amino acids: | 223 | ||
| Molecular weight: | 10,550.758 | ||
| Theoretical pI: | 10.543 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11125 | ||
| Instability index: | 88.885 | ||
| aromaticity | 0.040 | ||
| GRAVY | -0.577 | ||
Secondary Structure Fraction | |||
| Helix | 0.149 | ||
| turn | 0.465 | ||
| sheet | 0.218 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341790.1 | 3prime_partial | 222 | 85-750(+) |
Amino Acid sequence : | |||
| MLSVAAAETQNPELSSHALPQTQTSQETHIFVSKLPSIPIPNHLPLHTYCFQNLSQFPDRPCLIAGNSGKSYSFAETHLICRKVAAGFANLGLKRGDVVMVLLQNCAEFVFTFMGASMIG AVTTTANPFCTSKEIFKQFNASNSKVIITQSQYVSKLRDTGDDSLVFGEDFSVFTIDAPPEGCLHFSTLSEADEAEAPEVEIDPDDAVALPFSSGTTGLPKG | |||
Physicochemical properties | |||
| Number of amino acids: | 222 | ||
| Molecular weight: | 10,550.758 | ||
| Theoretical pI: | 10.543 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11125 | ||
| Instability index: | 88.885 | ||
| aromaticity | 0.040 | ||
| GRAVY | -0.577 | ||
Secondary Structure Fraction | |||
| Helix | 0.149 | ||
| turn | 0.465 | ||
| sheet | 0.218 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341790.1 | 5prime_partial | 189 | 3-572(+) |
Amino Acid sequence : | |||
| SVVKTKINTYTLSSPAVDIKQNPSIINNVVCGGCRNSESRAFLSCSPPNSNLPRNSYFCLQTPLHSHPQPPPSPHILLPEPLPIPRPPMPHRRQFWQILLLCRDAPHLPQSRRRLRQPRT QERRRRHGAAPELRRIRLHFHGSFHDRRRHHHRQPFLHLQRDLQAIQRLQLQGHHHAVPVRQQAPGHRR* | |||
Physicochemical properties | |||
| Number of amino acids: | 189 | ||
| Molecular weight: | 10,550.758 | ||
| Theoretical pI: | 10.543 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11125 | ||
| Instability index: | 88.885 | ||
| aromaticity | 0.040 | ||
| GRAVY | -0.577 | ||
Secondary Structure Fraction | |||
| Helix | 0.149 | ||
| turn | 0.465 | ||
| sheet | 0.218 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341790.1 | 5prime_partial | 151 | 752-297(-) |
Amino Acid sequence : | |||
| TPFGNPVVPEEKGSATASSGSISTSGASASSASERVEKCKHPSGGASMVKTEKSSPKTRESSPVSRSLLTYWDCVMMTLELEALNCLKISLEVQKGLAVVVTAPIMEAPMKVKTNSAQFW SSTMTTSPLLSPRLAKPAATLRQMRCVSAKE* | |||
Physicochemical properties | |||
| Number of amino acids: | 151 | ||
| Molecular weight: | 10,550.758 | ||
| Theoretical pI: | 10.543 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11125 | ||
| Instability index: | 88.885 | ||
| aromaticity | 0.040 | ||
| GRAVY | -0.577 | ||
Secondary Structure Fraction | |||
| Helix | 0.149 | ||
| turn | 0.465 | ||
| sheet | 0.218 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341790.1 | complete | 101 | 134-439(+) |
Amino Acid sequence : | |||
| MLSPKLKPPKKLIFLSPNSPPFPSPTTSLSTHTASRTSPNSPTAHASSPAILANPTPLPRRTSSAAKSPPASPTSDSREATSSWCCSRTAPNSSSLSWELP* | |||
Physicochemical properties | |||
| Number of amino acids: | 101 | ||
| Molecular weight: | 10,550.758 | ||
| Theoretical pI: | 10.543 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11125 | ||
| Instability index: | 88.885 | ||
| aromaticity | 0.040 | ||
| GRAVY | -0.577 | ||
Secondary Structure Fraction | |||
| Helix | 0.149 | ||
| turn | 0.465 | ||
| sheet | 0.218 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341790.1 | 5prime_partial | 223 | 750-79(-) |
Amino Acid sequence : | |||
| TFRQSGGAGGEGQRNGVVWIDLNLRRLRLVGFREGREMQASLRRGVDGEDGEILTEDEGVIACVPELADVLGLRDDDLGVGGVELLEDLFGGAERVGGGGDGADHGSSHESEDEFGAVLE QHHDDVASLESEVGEAGGDFAADEVRLGKGVGFARIAGDEAWAVGELGEVLEAVCVEREVVGDGNGGEFGDKNMSFLGGLSLGESMRGKLGILSFGSRHRQHC* | |||
Physicochemical properties | |||
| Number of amino acids: | 223 | ||
| Molecular weight: | 10,550.758 | ||
| Theoretical pI: | 10.543 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11125 | ||
| Instability index: | 88.885 | ||
| aromaticity | 0.040 | ||
| GRAVY | -0.577 | ||
Secondary Structure Fraction | |||
| Helix | 0.149 | ||
| turn | 0.465 | ||
| sheet | 0.218 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341790.1 | 3prime_partial | 222 | 85-750(+) |
Amino Acid sequence : | |||
| MLSVAAAETQNPELSSHALPQTQTSQETHIFVSKLPSIPIPNHLPLHTYCFQNLSQFPDRPCLIAGNSGKSYSFAETHLICRKVAAGFANLGLKRGDVVMVLLQNCAEFVFTFMGASMIG AVTTTANPFCTSKEIFKQFNASNSKVIITQSQYVSKLRDTGDDSLVFGEDFSVFTIDAPPEGCLHFSTLSEADEAEAPEVEIDPDDAVALPFSSGTTGLPKG | |||
Physicochemical properties | |||
| Number of amino acids: | 222 | ||
| Molecular weight: | 10,550.758 | ||
| Theoretical pI: | 10.543 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11125 | ||
| Instability index: | 88.885 | ||
| aromaticity | 0.040 | ||
| GRAVY | -0.577 | ||
Secondary Structure Fraction | |||
| Helix | 0.149 | ||
| turn | 0.465 | ||
| sheet | 0.218 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341790.1 | 5prime_partial | 189 | 3-572(+) |
Amino Acid sequence : | |||
| SVVKTKINTYTLSSPAVDIKQNPSIINNVVCGGCRNSESRAFLSCSPPNSNLPRNSYFCLQTPLHSHPQPPPSPHILLPEPLPIPRPPMPHRRQFWQILLLCRDAPHLPQSRRRLRQPRT QERRRRHGAAPELRRIRLHFHGSFHDRRRHHHRQPFLHLQRDLQAIQRLQLQGHHHAVPVRQQAPGHRR* | |||
Physicochemical properties | |||
| Number of amino acids: | 189 | ||
| Molecular weight: | 10,550.758 | ||
| Theoretical pI: | 10.543 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11125 | ||
| Instability index: | 88.885 | ||
| aromaticity | 0.040 | ||
| GRAVY | -0.577 | ||
Secondary Structure Fraction | |||
| Helix | 0.149 | ||
| turn | 0.465 | ||
| sheet | 0.218 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341790.1 | 5prime_partial | 151 | 752-297(-) |
Amino Acid sequence : | |||
| TPFGNPVVPEEKGSATASSGSISTSGASASSASERVEKCKHPSGGASMVKTEKSSPKTRESSPVSRSLLTYWDCVMMTLELEALNCLKISLEVQKGLAVVVTAPIMEAPMKVKTNSAQFW SSTMTTSPLLSPRLAKPAATLRQMRCVSAKE* | |||
Physicochemical properties | |||
| Number of amino acids: | 151 | ||
| Molecular weight: | 10,550.758 | ||
| Theoretical pI: | 10.543 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11125 | ||
| Instability index: | 88.885 | ||
| aromaticity | 0.040 | ||
| GRAVY | -0.577 | ||
Secondary Structure Fraction | |||
| Helix | 0.149 | ||
| turn | 0.465 | ||
| sheet | 0.218 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341790.1 | complete | 101 | 134-439(+) |
Amino Acid sequence : | |||
| MLSPKLKPPKKLIFLSPNSPPFPSPTTSLSTHTASRTSPNSPTAHASSPAILANPTPLPRRTSSAAKSPPASPTSDSREATSSWCCSRTAPNSSSLSWELP* | |||
Physicochemical properties | |||
| Number of amino acids: | 101 | ||
| Molecular weight: | 10,550.758 | ||
| Theoretical pI: | 10.543 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11125 | ||
| Instability index: | 88.885 | ||
| aromaticity | 0.040 | ||
| GRAVY | -0.577 | ||
Secondary Structure Fraction | |||
| Helix | 0.149 | ||
| turn | 0.465 | ||
| sheet | 0.218 | ||