Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY341794.1 | complete | 168 | 34-540(+) |
Amino Acid sequence : | |||
MSGPVKKVADVAFKAGKTIDWEGMAKLLVSDEARREFATLRRAFDDVNAQLQTKFSQEPQPIDWEYYRKGIGSRLVDMYKQAYDEIKIPQYVDNVTPQYKPKFDALLVELKEAEQQSLKE SERLEKEVAEVQDLKKRLSTMTADEYFEKHPELRKKFDDEIRNDYWGY* | |||
Physicochemical properties | |||
Number of amino acids: | 168 | ||
Molecular weight: | 19,811.164 | ||
Theoretical pI: | 5.278 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 29910 29910 | ||
Instability index: | 42.143 | ||
aromaticity | 0.113 | ||
GRAVY | -0.880 | ||
Secondary Structure Fraction | |||
Helix | 0.292 | ||
turn | 0.137 | ||
sheet | 0.286 |