Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY341803.1 | 5prime_partial | 185 | 3-560(+) |
Amino Acid sequence : | |||
DIVGVPTSKRTQEQAAALGIPLSTLDAHPHIDLAIDGADEVDPNLDLVKGRGGALLREKMVEAASDKFVVVVDDSKLVLGLGGSGLAMPVEVVQFCWNYNLVRLQDLFKEEGCDAKLRLD GDGKPYVTDNSNYIVDLYFKTPIKDSAAAGKEIAALEGVVEHGLFLGMTTAVIIAGGSGVTVKTK* | |||
Physicochemical properties | |||
Number of amino acids: | 185 | ||
Molecular weight: | 19,565.170 | ||
Theoretical pI: | 4.755 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11585 | ||
Instability index: | 21.853 | ||
aromaticity | 0.054 | ||
GRAVY | 0.102 | ||
Secondary Structure Fraction | |||
Helix | 0.330 | ||
turn | 0.216 | ||
sheet | 0.281 |