| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341803.1 | 5prime_partial | 185 | 3-560(+) |
Amino Acid sequence : | |||
| DIVGVPTSKRTQEQAAALGIPLSTLDAHPHIDLAIDGADEVDPNLDLVKGRGGALLREKMVEAASDKFVVVVDDSKLVLGLGGSGLAMPVEVVQFCWNYNLVRLQDLFKEEGCDAKLRLD GDGKPYVTDNSNYIVDLYFKTPIKDSAAAGKEIAALEGVVEHGLFLGMTTAVIIAGGSGVTVKTK* | |||
Physicochemical properties | |||
| Number of amino acids: | 185 | ||
| Molecular weight: | 19,565.170 | ||
| Theoretical pI: | 4.755 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11585 | ||
| Instability index: | 21.853 | ||
| aromaticity | 0.054 | ||
| GRAVY | 0.102 | ||
Secondary Structure Fraction | |||
| Helix | 0.330 | ||
| turn | 0.216 | ||
| sheet | 0.281 | ||