| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341806.1 | internal | 253 | 1-759(+) |
Amino Acid sequence : | |||
| RFSSLPPTNFKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK EGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM QIFVKTLTGKTIT | |||
Physicochemical properties | |||
| Number of amino acids: | 253 | ||
| Molecular weight: | 18,725.435 | ||
| Theoretical pI: | 4.050 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
| Instability index: | 22.783 | ||
| aromaticity | 0.045 | ||
| GRAVY | -0.034 | ||
Secondary Structure Fraction | |||
| Helix | 0.333 | ||
| turn | 0.220 | ||
| sheet | 0.350 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341806.1 | 5prime_partial | 177 | 759-226(-) |
Amino Acid sequence : | |||
| GDGLPGQSLDEDLHTTAETEDQVEGGFLLNVVVGEGAPVLELLAGKNQPLLVRGNAFLVLNFRLNIVDRVRALDLQGDGFSGEGLDEDLHATTETEDQMEGGFLLDVVVGEGAAIFELLA GKNEPLLVRGNALLVLDLGFDVVDRVGTLDFEGDGLAGQGLDEDLHTTTETEDQVEG* | |||
Physicochemical properties | |||
| Number of amino acids: | 177 | ||
| Molecular weight: | 18,725.435 | ||
| Theoretical pI: | 4.050 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
| Instability index: | 22.783 | ||
| aromaticity | 0.045 | ||
| GRAVY | -0.034 | ||
Secondary Structure Fraction | |||
| Helix | 0.333 | ||
| turn | 0.220 | ||
| sheet | 0.350 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341806.1 | internal | 253 | 1-759(+) |
Amino Acid sequence : | |||
| RFSSLPPTNFKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK EGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM QIFVKTLTGKTIT | |||
Physicochemical properties | |||
| Number of amino acids: | 253 | ||
| Molecular weight: | 18,725.435 | ||
| Theoretical pI: | 4.050 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
| Instability index: | 22.783 | ||
| aromaticity | 0.045 | ||
| GRAVY | -0.034 | ||
Secondary Structure Fraction | |||
| Helix | 0.333 | ||
| turn | 0.220 | ||
| sheet | 0.350 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341806.1 | 5prime_partial | 177 | 759-226(-) |
Amino Acid sequence : | |||
| GDGLPGQSLDEDLHTTAETEDQVEGGFLLNVVVGEGAPVLELLAGKNQPLLVRGNAFLVLNFRLNIVDRVRALDLQGDGFSGEGLDEDLHATTETEDQMEGGFLLDVVVGEGAAIFELLA GKNEPLLVRGNALLVLDLGFDVVDRVGTLDFEGDGLAGQGLDEDLHTTTETEDQVEG* | |||
Physicochemical properties | |||
| Number of amino acids: | 177 | ||
| Molecular weight: | 18,725.435 | ||
| Theoretical pI: | 4.050 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
| Instability index: | 22.783 | ||
| aromaticity | 0.045 | ||
| GRAVY | -0.034 | ||
Secondary Structure Fraction | |||
| Helix | 0.333 | ||
| turn | 0.220 | ||
| sheet | 0.350 | ||