| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341833.1 | 5prime_partial | 116 | 3-353(+) |
Amino Acid sequence : | |||
| EELDLDVLVHGEPERNDMGEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTVFWSTAAQSMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDL* | |||
Physicochemical properties | |||
| Number of amino acids: | 116 | ||
| Molecular weight: | 13,151.803 | ||
| Theoretical pI: | 4.774 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22460 22585 | ||
| Instability index: | 31.262 | ||
| aromaticity | 0.112 | ||
| GRAVY | -0.338 | ||
Secondary Structure Fraction | |||
| Helix | 0.302 | ||
| turn | 0.241 | ||
| sheet | 0.241 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341833.1 | 5prime_partial | 116 | 3-353(+) |
Amino Acid sequence : | |||
| EELDLDVLVHGEPERNDMGEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTVFWSTAAQSMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDL* | |||
Physicochemical properties | |||
| Number of amino acids: | 116 | ||
| Molecular weight: | 13,151.803 | ||
| Theoretical pI: | 4.774 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22460 22585 | ||
| Instability index: | 31.262 | ||
| aromaticity | 0.112 | ||
| GRAVY | -0.338 | ||
Secondary Structure Fraction | |||
| Helix | 0.302 | ||
| turn | 0.241 | ||
| sheet | 0.241 | ||