| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341835.1 | 5prime_partial | 218 | 2-658(+) |
Amino Acid sequence : | |||
| HAPINEDNVLYIVENIIVAAIETTLWSIEWGIAELVNHPEIQKKLRDELDTVLGPGVQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNP AQWKKPEEFRPERFLEEEAKVEANGNDFRYLPFGVGRRSCPGIILALPILGITLGRLVQNFELLPPPGQSKIDTTEKGGQFSLHILKHSTIVLKPRSV* | |||
Physicochemical properties | |||
| Number of amino acids: | 218 | ||
| Molecular weight: | 13,726.682 | ||
| Theoretical pI: | 5.662 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12615 | ||
| Instability index: | 41.584 | ||
| aromaticity | 0.049 | ||
| GRAVY | -0.185 | ||
Secondary Structure Fraction | |||
| Helix | 0.328 | ||
| turn | 0.189 | ||
| sheet | 0.320 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341835.1 | complete | 122 | 625-257(-) |
Amino Acid sequence : | |||
| MLQNVKTELATFLRRIDLRLPWWRQQLEVLYESAQRNTQNRQCKDNTRAAPSADAEGEVPKVIAIGLDFSLLLQESLGPELLGLFPLGRVVGKPPRIHQDLALGRDVVATELCIMEVHVG DQ* | |||
Physicochemical properties | |||
| Number of amino acids: | 122 | ||
| Molecular weight: | 13,726.682 | ||
| Theoretical pI: | 5.662 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12615 | ||
| Instability index: | 41.584 | ||
| aromaticity | 0.049 | ||
| GRAVY | -0.185 | ||
Secondary Structure Fraction | |||
| Helix | 0.328 | ||
| turn | 0.189 | ||
| sheet | 0.320 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341835.1 | 5prime_partial | 218 | 2-658(+) |
Amino Acid sequence : | |||
| HAPINEDNVLYIVENIIVAAIETTLWSIEWGIAELVNHPEIQKKLRDELDTVLGPGVQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNP AQWKKPEEFRPERFLEEEAKVEANGNDFRYLPFGVGRRSCPGIILALPILGITLGRLVQNFELLPPPGQSKIDTTEKGGQFSLHILKHSTIVLKPRSV* | |||
Physicochemical properties | |||
| Number of amino acids: | 218 | ||
| Molecular weight: | 13,726.682 | ||
| Theoretical pI: | 5.662 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12615 | ||
| Instability index: | 41.584 | ||
| aromaticity | 0.049 | ||
| GRAVY | -0.185 | ||
Secondary Structure Fraction | |||
| Helix | 0.328 | ||
| turn | 0.189 | ||
| sheet | 0.320 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341835.1 | complete | 122 | 625-257(-) |
Amino Acid sequence : | |||
| MLQNVKTELATFLRRIDLRLPWWRQQLEVLYESAQRNTQNRQCKDNTRAAPSADAEGEVPKVIAIGLDFSLLLQESLGPELLGLFPLGRVVGKPPRIHQDLALGRDVVATELCIMEVHVG DQ* | |||
Physicochemical properties | |||
| Number of amino acids: | 122 | ||
| Molecular weight: | 13,726.682 | ||
| Theoretical pI: | 5.662 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12615 | ||
| Instability index: | 41.584 | ||
| aromaticity | 0.049 | ||
| GRAVY | -0.185 | ||
Secondary Structure Fraction | |||
| Helix | 0.328 | ||
| turn | 0.189 | ||
| sheet | 0.320 | ||