Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY341836.1 | internal | 247 | 742-2(-) |
Amino Acid sequence : | |||
RIIVIDSREKQSAISMHMIQRLDTSSSLLRNTNQSLVHLPVLARMCVQPISDHSQHYLKLRIIGGTRLRHLPRLVVVLLRLHTLVNQQRSITTVVNDQIGAAAGAPVEGALGAPPVLLQG LSFPREHGSAVAGDGGGSVVLSREDVAGAPSDLSAEGSEGLNQDGGLDGHVEAASDSGALEGLRGPELGPAGHEARHFDLGELDLEAAEVGMGHVLDLVLAAGVGLLDLERHGLREIDWI KGFGFVL | |||
Physicochemical properties | |||
Number of amino acids: | 247 | ||
Molecular weight: | 17,994.235 | ||
Theoretical pI: | 5.322 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 33460 33710 | ||
Instability index: | 46.248 | ||
aromaticity | 0.098 | ||
GRAVY | -0.175 | ||
Secondary Structure Fraction | |||
Helix | 0.276 | ||
turn | 0.209 | ||
sheet | 0.307 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY341836.1 | 5prime_partial | 163 | 2-493(+) |
Amino Acid sequence : | |||
KNETKPFYPIYFSQPMALQVEKTNSGREYKVKDMSHADFGRLEIELAEVEMPGLMSCRAEFGASQPFKGARITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARNSAA VFAWKGETLQEYWWCTERALHWGPGGGPDLIVDDGGDATLLIH* | |||
Physicochemical properties | |||
Number of amino acids: | 163 | ||
Molecular weight: | 17,994.235 | ||
Theoretical pI: | 5.322 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 33460 33710 | ||
Instability index: | 46.248 | ||
aromaticity | 0.098 | ||
GRAVY | -0.175 | ||
Secondary Structure Fraction | |||
Helix | 0.276 | ||
turn | 0.209 | ||
sheet | 0.307 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY341836.1 | internal | 247 | 742-2(-) |
Amino Acid sequence : | |||
RIIVIDSREKQSAISMHMIQRLDTSSSLLRNTNQSLVHLPVLARMCVQPISDHSQHYLKLRIIGGTRLRHLPRLVVVLLRLHTLVNQQRSITTVVNDQIGAAAGAPVEGALGAPPVLLQG LSFPREHGSAVAGDGGGSVVLSREDVAGAPSDLSAEGSEGLNQDGGLDGHVEAASDSGALEGLRGPELGPAGHEARHFDLGELDLEAAEVGMGHVLDLVLAAGVGLLDLERHGLREIDWI KGFGFVL | |||
Physicochemical properties | |||
Number of amino acids: | 247 | ||
Molecular weight: | 17,994.235 | ||
Theoretical pI: | 5.322 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 33460 33710 | ||
Instability index: | 46.248 | ||
aromaticity | 0.098 | ||
GRAVY | -0.175 | ||
Secondary Structure Fraction | |||
Helix | 0.276 | ||
turn | 0.209 | ||
sheet | 0.307 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY341836.1 | 5prime_partial | 163 | 2-493(+) |
Amino Acid sequence : | |||
KNETKPFYPIYFSQPMALQVEKTNSGREYKVKDMSHADFGRLEIELAEVEMPGLMSCRAEFGASQPFKGARITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARNSAA VFAWKGETLQEYWWCTERALHWGPGGGPDLIVDDGGDATLLIH* | |||
Physicochemical properties | |||
Number of amino acids: | 163 | ||
Molecular weight: | 17,994.235 | ||
Theoretical pI: | 5.322 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 33460 33710 | ||
Instability index: | 46.248 | ||
aromaticity | 0.098 | ||
GRAVY | -0.175 | ||
Secondary Structure Fraction | |||
Helix | 0.276 | ||
turn | 0.209 | ||
sheet | 0.307 |