Acc_NO	ORF type	length	start-end position (strand +/-)
>DY341855.1	complete	147	60-503(+)
Amino Acid sequence :
MIVSKYPSINGINFDLPHVIEDAPSYPGVEHVGGDMFVSVPKGDAIFMKWICHDWSDEHCVKFLKNCYDALPQNGKVILAECVLPEAPDTGLATKNVVHIDVIMLAHNPGGKERTEKEFQ GLAKAAGFKQFNKACCAYNTWIMELLK*
Physicochemical properties
Number of amino acids:		147
Molecular weight:		16,321.736
Theoretical pI:		5.821
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		22460 22835
Instability index:		34.918
aromaticity		0.095
GRAVY		-0.070
Secondary Structure Fraction
Helix		0.313
turn		0.224
sheet		0.245