| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341872.1 | internal | 104 | 314-3(-) |
Amino Acid sequence : | |||
| KAFGTKVTVISTSLSKKEEAMQHLGVDEFVVSTDPQQMQAAVGTLDGIIDTVSAPHPIVPLLSLLKPHGKLIVVGLPDKPLQLPVFPLIQGRRTIAGSGIGGLK | |||
Physicochemical properties | |||
| Number of amino acids: | 104 | ||
| Molecular weight: | 10,914.738 | ||
| Theoretical pI: | 9.165 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
| Instability index: | 17.648 | ||
| aromaticity | 0.029 | ||
| GRAVY | 0.255 | ||
Secondary Structure Fraction | |||
| Helix | 0.337 | ||
| turn | 0.260 | ||
| sheet | 0.231 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341872.1 | internal | 104 | 314-3(-) |
Amino Acid sequence : | |||
| KAFGTKVTVISTSLSKKEEAMQHLGVDEFVVSTDPQQMQAAVGTLDGIIDTVSAPHPIVPLLSLLKPHGKLIVVGLPDKPLQLPVFPLIQGRRTIAGSGIGGLK | |||
Physicochemical properties | |||
| Number of amino acids: | 104 | ||
| Molecular weight: | 10,914.738 | ||
| Theoretical pI: | 9.165 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
| Instability index: | 17.648 | ||
| aromaticity | 0.029 | ||
| GRAVY | 0.255 | ||
Secondary Structure Fraction | |||
| Helix | 0.337 | ||
| turn | 0.260 | ||
| sheet | 0.231 | ||