| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341881.1 | 5prime_partial | 157 | 686-213(-) |
Amino Acid sequence : | |||
| GDLPRPVRVDKHRQRFRHTDGVRDLHDAPPGEPVGDDALGRLPEDVGTSPVDLGGVLPREGPATVGPPPAVGVDDDLTAGETRVAVGPTDDEPPGGIQVEDGFLVQILLGDHRLDDVLLE ILGDLVVGDGLVVLGRDEDGVDPDGDHRTVLVVVLDS* | |||
Physicochemical properties | |||
| Number of amino acids: | 157 | ||
| Molecular weight: | 15,808.907 | ||
| Theoretical pI: | 8.690 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 12950 | ||
| Instability index: | 9.241 | ||
| aromaticity | 0.075 | ||
| GRAVY | -0.082 | ||
Secondary Structure Fraction | |||
| Helix | 0.320 | ||
| turn | 0.245 | ||
| sheet | 0.170 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341881.1 | 3prime_partial | 147 | 246-686(+) |
Amino Acid sequence : | |||
| MVPIRVHTVLISTQHDETVTNDEIAKDLKEHVIKAVIPEKYLDEKTIFHLNPSGRFVIGGPHGDAGLTGRKIIIDTYGGWGAHGGGAFSGKDPTKVDRTGAYIFRQAAKSIVANGLARRC IVQVSYAIGVPEPLSVFVDSYGTGKIP | |||
Physicochemical properties | |||
| Number of amino acids: | 147 | ||
| Molecular weight: | 15,808.907 | ||
| Theoretical pI: | 8.690 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 12950 | ||
| Instability index: | 9.241 | ||
| aromaticity | 0.075 | ||
| GRAVY | -0.082 | ||
Secondary Structure Fraction | |||
| Helix | 0.320 | ||
| turn | 0.245 | ||
| sheet | 0.170 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341881.1 | 5prime_partial | 157 | 686-213(-) |
Amino Acid sequence : | |||
| GDLPRPVRVDKHRQRFRHTDGVRDLHDAPPGEPVGDDALGRLPEDVGTSPVDLGGVLPREGPATVGPPPAVGVDDDLTAGETRVAVGPTDDEPPGGIQVEDGFLVQILLGDHRLDDVLLE ILGDLVVGDGLVVLGRDEDGVDPDGDHRTVLVVVLDS* | |||
Physicochemical properties | |||
| Number of amino acids: | 157 | ||
| Molecular weight: | 15,808.907 | ||
| Theoretical pI: | 8.690 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 12950 | ||
| Instability index: | 9.241 | ||
| aromaticity | 0.075 | ||
| GRAVY | -0.082 | ||
Secondary Structure Fraction | |||
| Helix | 0.320 | ||
| turn | 0.245 | ||
| sheet | 0.170 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341881.1 | 3prime_partial | 147 | 246-686(+) |
Amino Acid sequence : | |||
| MVPIRVHTVLISTQHDETVTNDEIAKDLKEHVIKAVIPEKYLDEKTIFHLNPSGRFVIGGPHGDAGLTGRKIIIDTYGGWGAHGGGAFSGKDPTKVDRTGAYIFRQAAKSIVANGLARRC IVQVSYAIGVPEPLSVFVDSYGTGKIP | |||
Physicochemical properties | |||
| Number of amino acids: | 147 | ||
| Molecular weight: | 15,808.907 | ||
| Theoretical pI: | 8.690 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 12950 | ||
| Instability index: | 9.241 | ||
| aromaticity | 0.075 | ||
| GRAVY | -0.082 | ||
Secondary Structure Fraction | |||
| Helix | 0.320 | ||
| turn | 0.245 | ||
| sheet | 0.170 | ||