| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341887.1 | internal | 222 | 3-668(+) |
Amino Acid sequence : | |||
| FPFLTSNPALLAQPLALQVEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLISCRTEFGPSQPFKGARITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAV FAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYEKSGKLPDPSSTDNAEFQIVLTLIRDGLKADPTKYRKMKERLVGVSEETTT | |||
Physicochemical properties | |||
| Number of amino acids: | 222 | ||
| Molecular weight: | 21,782.114 | ||
| Theoretical pI: | 4.589 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 43.381 | ||
| aromaticity | 0.028 | ||
| GRAVY | 0.014 | ||
Secondary Structure Fraction | |||
| Helix | 0.302 | ||
| turn | 0.307 | ||
| sheet | 0.335 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341887.1 | 5prime_partial | 212 | 668-30(-) |
Amino Acid sequence : | |||
| SSCFLRNTNQSLLHLPVLGGIGLQPISDQRQHYLKLRIIGRAGVRQLPTFLVLLLRFDALVNQQRGITAVVDDEIGAAARPPIEGPLGAPPVLLQGFALPGEDGGAVASNGSGGVVLSGE DVARAPSDLSSESGEGLDEDGSLDGHVETSGDAGTLEGLGGTELGPAGNEARHLHLGELDFEAAEVGLGHVLDLVLAARGGLLNLERQGLSE* | |||
Physicochemical properties | |||
| Number of amino acids: | 212 | ||
| Molecular weight: | 21,782.114 | ||
| Theoretical pI: | 4.589 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 43.381 | ||
| aromaticity | 0.028 | ||
| GRAVY | 0.014 | ||
Secondary Structure Fraction | |||
| Helix | 0.302 | ||
| turn | 0.307 | ||
| sheet | 0.335 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341887.1 | internal | 222 | 3-668(+) |
Amino Acid sequence : | |||
| FPFLTSNPALLAQPLALQVEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLISCRTEFGPSQPFKGARITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAV FAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYEKSGKLPDPSSTDNAEFQIVLTLIRDGLKADPTKYRKMKERLVGVSEETTT | |||
Physicochemical properties | |||
| Number of amino acids: | 222 | ||
| Molecular weight: | 21,782.114 | ||
| Theoretical pI: | 4.589 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 43.381 | ||
| aromaticity | 0.028 | ||
| GRAVY | 0.014 | ||
Secondary Structure Fraction | |||
| Helix | 0.302 | ||
| turn | 0.307 | ||
| sheet | 0.335 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341887.1 | 5prime_partial | 212 | 668-30(-) |
Amino Acid sequence : | |||
| SSCFLRNTNQSLLHLPVLGGIGLQPISDQRQHYLKLRIIGRAGVRQLPTFLVLLLRFDALVNQQRGITAVVDDEIGAAARPPIEGPLGAPPVLLQGFALPGEDGGAVASNGSGGVVLSGE DVARAPSDLSSESGEGLDEDGSLDGHVETSGDAGTLEGLGGTELGPAGNEARHLHLGELDFEAAEVGLGHVLDLVLAARGGLLNLERQGLSE* | |||
Physicochemical properties | |||
| Number of amino acids: | 212 | ||
| Molecular weight: | 21,782.114 | ||
| Theoretical pI: | 4.589 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 43.381 | ||
| aromaticity | 0.028 | ||
| GRAVY | 0.014 | ||
Secondary Structure Fraction | |||
| Helix | 0.302 | ||
| turn | 0.307 | ||
| sheet | 0.335 | ||