Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY341891.1 | complete | 126 | 64-444(+) |
Amino Acid sequence : | |||
MLLNIHLSSRASNLFGSSTEGLHGKFWQTSAMTLSDAKLFFAMSAIFSLFVSQNRISSASSGAIWITVLLGLEEEWAAANILSNPTDDLRPTTTTCVSRRGGEHVCTATHQRHRHCHLFQ PPLKYS* | |||
Physicochemical properties | |||
Number of amino acids: | 126 | ||
Molecular weight: | 13,919.673 | ||
Theoretical pI: | 8.617 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 17990 18115 | ||
Instability index: | 51.335 | ||
aromaticity | 0.087 | ||
GRAVY | -0.049 | ||
Secondary Structure Fraction | |||
Helix | 0.286 | ||
turn | 0.262 | ||
sheet | 0.270 |