| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341891.1 | complete | 126 | 64-444(+) |
Amino Acid sequence : | |||
| MLLNIHLSSRASNLFGSSTEGLHGKFWQTSAMTLSDAKLFFAMSAIFSLFVSQNRISSASSGAIWITVLLGLEEEWAAANILSNPTDDLRPTTTTCVSRRGGEHVCTATHQRHRHCHLFQ PPLKYS* | |||
Physicochemical properties | |||
| Number of amino acids: | 126 | ||
| Molecular weight: | 13,919.673 | ||
| Theoretical pI: | 8.617 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 17990 18115 | ||
| Instability index: | 51.335 | ||
| aromaticity | 0.087 | ||
| GRAVY | -0.049 | ||
Secondary Structure Fraction | |||
| Helix | 0.286 | ||
| turn | 0.262 | ||
| sheet | 0.270 | ||