| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341897.1 | 5prime_partial | 123 | 2-373(+) |
Amino Acid sequence : | |||
| QIHTHLCYSNFNDIIHSIINMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLAVLETNILWVNPDCGLKTRKYGEVKPALENMVAAAKLLRTQLA SAK* | |||
Physicochemical properties | |||
| Number of amino acids: | 123 | ||
| Molecular weight: | 11,176.958 | ||
| Theoretical pI: | 9.298 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15470 | ||
| Instability index: | 59.456 | ||
| aromaticity | 0.110 | ||
| GRAVY | 0.192 | ||
Secondary Structure Fraction | |||
| Helix | 0.320 | ||
| turn | 0.300 | ||
| sheet | 0.270 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341897.1 | complete | 100 | 324-22(-) |
Amino Acid sequence : | |||
| MFSRAGFTSPYLRVLRPQSGFTHKMLVSRTASILLILSAISSVDGILGEWMSYTPGPIPAPYFTPSRKTDSSFSSDREFSIVITSASMLMMEWMMSLKLE* | |||
Physicochemical properties | |||
| Number of amino acids: | 100 | ||
| Molecular weight: | 11,176.958 | ||
| Theoretical pI: | 9.298 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15470 | ||
| Instability index: | 59.456 | ||
| aromaticity | 0.110 | ||
| GRAVY | 0.192 | ||
Secondary Structure Fraction | |||
| Helix | 0.320 | ||
| turn | 0.300 | ||
| sheet | 0.270 | ||