| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341908.1 | 5prime_partial | 157 | 3-476(+) |
Amino Acid sequence : | |||
| FVLSFSCFAAGHTFNRSSFPSDFIFGAASSAYQFEGAAFEDGKGASIWDTYTHKFPERIEDRSNGDVANDFYHRYKDDVKLMKYIGLDTFRLSISWSRILPNGKVRGGINKEGMAFYNNV FNKLLSNGITPFVTLFHWDVPQALEDEYGGFLNPRIM* | |||
Physicochemical properties | |||
| Number of amino acids: | 157 | ||
| Molecular weight: | 17,853.814 | ||
| Theoretical pI: | 6.079 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 26930 26930 | ||
| Instability index: | 35.274 | ||
| aromaticity | 0.172 | ||
| GRAVY | -0.275 | ||
Secondary Structure Fraction | |||
| Helix | 0.338 | ||
| turn | 0.274 | ||
| sheet | 0.197 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341908.1 | 5prime_partial | 157 | 3-476(+) |
Amino Acid sequence : | |||
| FVLSFSCFAAGHTFNRSSFPSDFIFGAASSAYQFEGAAFEDGKGASIWDTYTHKFPERIEDRSNGDVANDFYHRYKDDVKLMKYIGLDTFRLSISWSRILPNGKVRGGINKEGMAFYNNV FNKLLSNGITPFVTLFHWDVPQALEDEYGGFLNPRIM* | |||
Physicochemical properties | |||
| Number of amino acids: | 157 | ||
| Molecular weight: | 17,853.814 | ||
| Theoretical pI: | 6.079 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 26930 26930 | ||
| Instability index: | 35.274 | ||
| aromaticity | 0.172 | ||
| GRAVY | -0.275 | ||
Secondary Structure Fraction | |||
| Helix | 0.338 | ||
| turn | 0.274 | ||
| sheet | 0.197 | ||