| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341909.1 | 5prime_partial | 169 | 566-57(-) |
Amino Acid sequence : | |||
| TRPRAEFGTRVLFVLFSSCFAAGHTFNRSSFPSDFIFGAASSAYQFEGAAFEDGKGASIWDTYTHKFPERIEDRSNGDVANDFYHRYKDDVKLMKYIGLDTFRLSISWSRILPNGKVRGG INKEGIAFYNNVFNKLLSNGITPFVTLFHWDVPQALEDEYGGFLNPRIM* | |||
Physicochemical properties | |||
| Number of amino acids: | 169 | ||
| Molecular weight: | 19,220.361 | ||
| Theoretical pI: | 6.844 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 26930 26930 | ||
| Instability index: | 33.578 | ||
| aromaticity | 0.166 | ||
| GRAVY | -0.286 | ||
Secondary Structure Fraction | |||
| Helix | 0.337 | ||
| turn | 0.266 | ||
| sheet | 0.195 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341909.1 | 5prime_partial | 169 | 566-57(-) |
Amino Acid sequence : | |||
| TRPRAEFGTRVLFVLFSSCFAAGHTFNRSSFPSDFIFGAASSAYQFEGAAFEDGKGASIWDTYTHKFPERIEDRSNGDVANDFYHRYKDDVKLMKYIGLDTFRLSISWSRILPNGKVRGG INKEGIAFYNNVFNKLLSNGITPFVTLFHWDVPQALEDEYGGFLNPRIM* | |||
Physicochemical properties | |||
| Number of amino acids: | 169 | ||
| Molecular weight: | 19,220.361 | ||
| Theoretical pI: | 6.844 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 26930 26930 | ||
| Instability index: | 33.578 | ||
| aromaticity | 0.166 | ||
| GRAVY | -0.286 | ||
Secondary Structure Fraction | |||
| Helix | 0.337 | ||
| turn | 0.266 | ||
| sheet | 0.195 | ||