| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341913.1 | complete | 200 | 46-648(+) |
Amino Acid sequence : | |||
| MGSLEVERKTVGWAARDPSGVLSPYEYTLRNTGPQDVYVKVMCCGICHTDVHQIKNDLGMSNYPMVPGHEVVGEVVEVGSEVTKFRAGDVVGVGCIVGSCGNCRPCYSDIEQYCNKKIWS YNDVYPDGKPTQGGFAGAMVVDQKFVVKIPDGMAPEQAAPLLCAGVTVYSPLNHFGLKQSGLRGGILGLGGVGHMGVNIA* | |||
Physicochemical properties | |||
| Number of amino acids: | 200 | ||
| Molecular weight: | 21,257.187 | ||
| Theoretical pI: | 5.925 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 24410 24910 | ||
| Instability index: | 29.396 | ||
| aromaticity | 0.075 | ||
| GRAVY | -0.010 | ||
Secondary Structure Fraction | |||
| Helix | 0.305 | ||
| turn | 0.295 | ||
| sheet | 0.185 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341913.1 | complete | 200 | 46-648(+) |
Amino Acid sequence : | |||
| MGSLEVERKTVGWAARDPSGVLSPYEYTLRNTGPQDVYVKVMCCGICHTDVHQIKNDLGMSNYPMVPGHEVVGEVVEVGSEVTKFRAGDVVGVGCIVGSCGNCRPCYSDIEQYCNKKIWS YNDVYPDGKPTQGGFAGAMVVDQKFVVKIPDGMAPEQAAPLLCAGVTVYSPLNHFGLKQSGLRGGILGLGGVGHMGVNIA* | |||
Physicochemical properties | |||
| Number of amino acids: | 200 | ||
| Molecular weight: | 21,257.187 | ||
| Theoretical pI: | 5.925 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 24410 24910 | ||
| Instability index: | 29.396 | ||
| aromaticity | 0.075 | ||
| GRAVY | -0.010 | ||
Secondary Structure Fraction | |||
| Helix | 0.305 | ||
| turn | 0.295 | ||
| sheet | 0.185 | ||