Acc_NO	ORF type	length	start-end position (strand +/-)
>DY341917.1	5prime_partial	107	684-361(-)
Amino Acid sequence :
KHSILILLLVANHHWLVDGLPGHPFNTVHFPIRTIRFCRHCFNVVPYFRRGEIDHGLQRSSTDLVLPLYALFLAFLDGFLHGLGLVGVRVDQELGVDLRQLVGGKWD*
Physicochemical properties
Number of amino acids:		107
Molecular weight:		11,887.025
Theoretical pI:		6.569
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		7450 7450
Instability index:		53.665
aromaticity		0.076
GRAVY		-0.952
Secondary Structure Fraction
Helix		0.257
turn		0.229
sheet		0.171

Acc_NO	ORF type	length	start-end position (strand +/-)
>DY341917.1	5prime_partial	105	1-318(+)
Amino Acid sequence :
SQTLGMPKSALDLLTDDKSGVNVRVNVGHGHDKDKDHKHDKDKDHYHDKDHGGSHKNHKPVNVNVSPIIYHYAATETQLHDSPNVALFFLEKDLYAGNKMTLQFY*
Physicochemical properties
Number of amino acids:		105
Molecular weight:		11,887.025
Theoretical pI:		6.569
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		7450 7450
Instability index:		53.665
aromaticity		0.076
GRAVY		-0.952
Secondary Structure Fraction
Helix		0.257
turn		0.229
sheet		0.171