Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY341918.1 | complete | 181 | 54-599(+) |
Amino Acid sequence : | |||
MKERPHITITSPIYTHHTRRQISDSQEYVKDTCTHVLKSKPHMKSMLNYSSNSSKATQCDSQGDNGRLAQSLASPSTPEKPNASGSTLPCPCGTPPQPQPLTHRPPREKRPTPPSSQSCG SKTQHTHTPAGGKPPPACRSASSTPFQYGTLSYPDYPLLSTLLQRCSLFSTWRNRPWTPEK* | |||
Physicochemical properties | |||
Number of amino acids: | 181 | ||
Molecular weight: | 18,043.409 | ||
Theoretical pI: | 5.888 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15970 | ||
Instability index: | 38.487 | ||
aromaticity | 0.055 | ||
GRAVY | -0.300 | ||
Secondary Structure Fraction | |||
Helix | 0.268 | ||
turn | 0.195 | ||
sheet | 0.262 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY341918.1 | 5prime_partial | 164 | 699-205(-) |
Amino Acid sequence : | |||
KFLVDPDSAEAEAMKKSIPECEEKGIKGEEKVCATSLESMVDFATSKIGNNVEAVSTEADSPDRKVCRIERVSRKPSDKPVVVCHQQEYEYAVFCCHKTETTVALDVSLVGAGGSKAEAV AVCHRDTAEWNPKHLAFQVLKVKPGTVPVCHYLLENHIVWLSKN* | |||
Physicochemical properties | |||
Number of amino acids: | 164 | ||
Molecular weight: | 18,043.409 | ||
Theoretical pI: | 5.888 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15970 | ||
Instability index: | 38.487 | ||
aromaticity | 0.055 | ||
GRAVY | -0.300 | ||
Secondary Structure Fraction | |||
Helix | 0.268 | ||
turn | 0.195 | ||
sheet | 0.262 |