Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY341949.1 | 5prime_partial | 166 | 584-84(-) |
Amino Acid sequence : | |||
HEAGVQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPAQWKKPEEFRPERFLEEEAKVEANGNDFRYLPFGVGRRSCPGIILALPILGI TLGRLVQNFELLPPPGQWKIDTTEKGGQFSLHILKHSTIVLKPRSV* | |||
Physicochemical properties | |||
Number of amino acids: | 166 | ||
Molecular weight: | 13,666.670 | ||
Theoretical pI: | 6.093 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12615 | ||
Instability index: | 38.427 | ||
aromaticity | 0.049 | ||
GRAVY | -0.165 | ||
Secondary Structure Fraction | |||
Helix | 0.328 | ||
turn | 0.197 | ||
sheet | 0.311 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY341949.1 | complete | 122 | 117-485(+) |
Amino Acid sequence : | |||
MLQNVKTELATFLRRIDLPLPWWRQQLEVLYESAQRNTQNRQCKDNTRAAPSADAEGEVPKVIAIGLDFSLLLQKSLGPELLGLFPLGRVVGKPPRIHQDLALGRDVVATELCIMEVHVG DQ* | |||
Physicochemical properties | |||
Number of amino acids: | 122 | ||
Molecular weight: | 13,666.670 | ||
Theoretical pI: | 6.093 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12615 | ||
Instability index: | 38.427 | ||
aromaticity | 0.049 | ||
GRAVY | -0.165 | ||
Secondary Structure Fraction | |||
Helix | 0.328 | ||
turn | 0.197 | ||
sheet | 0.311 |