| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341952.1 | 5prime_partial | 155 | 748-281(-) |
Amino Acid sequence : | |||
| TRPKQSLNPEMAMRTAAIAAANCQRGTGMGIKAFCSSFSSFPFNLPQNNNVQKTPPAEPSTNLFVSGLNKRTTSEGLRDAFAKFGEVVHAKVVTDRVSGFSKGFGFVKYATIEEAAEGIK GMDGQFLEGWVIFAEYARPRAPLPPPNNAPPQRQW* | |||
Physicochemical properties | |||
| Number of amino acids: | 155 | ||
| Molecular weight: | 14,202.193 | ||
| Theoretical pI: | 8.679 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 29450 29700 | ||
| Instability index: | 72.354 | ||
| aromaticity | 0.165 | ||
| GRAVY | 0.035 | ||
Secondary Structure Fraction | |||
| Helix | 0.372 | ||
| turn | 0.207 | ||
| sheet | 0.207 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341952.1 | 3prime_partial | 122 | 384-749(+) |
Amino Acid sequence : | |||
| MPLIPSAASSIVAYFTKPKPLENPDTRSVTTLACTTSPNLAKASRRPSLVVRLLSPETKRLVEGSAGGVFWTLLFCGRLNGKLENEEQKAFIPIPVPLWQLAAAIAAVLIAISGFKLCLG LV | |||
Physicochemical properties | |||
| Number of amino acids: | 122 | ||
| Molecular weight: | 14,202.193 | ||
| Theoretical pI: | 8.679 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 29450 29700 | ||
| Instability index: | 72.354 | ||
| aromaticity | 0.165 | ||
| GRAVY | 0.035 | ||
Secondary Structure Fraction | |||
| Helix | 0.372 | ||
| turn | 0.207 | ||
| sheet | 0.207 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341952.1 | complete | 121 | 251-616(+) |
Amino Acid sequence : | |||
| MTSFYLSVLTSPLTLRRSIVWWWQRSSRSRILCKYNPALQELAIHAFNTLCSFFYCCIFHETKTLGESRYTISDHFSMYHFTEFSKSITEAFTRCTFIKSRDEEIGGGFGGRSLLDVIIL W* | |||
Physicochemical properties | |||
| Number of amino acids: | 121 | ||
| Molecular weight: | 14,202.193 | ||
| Theoretical pI: | 8.679 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 29450 29700 | ||
| Instability index: | 72.354 | ||
| aromaticity | 0.165 | ||
| GRAVY | 0.035 | ||
Secondary Structure Fraction | |||
| Helix | 0.372 | ||
| turn | 0.207 | ||
| sheet | 0.207 | ||