| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341964.1 | 5prime_partial | 134 | 3-407(+) |
Amino Acid sequence : | |||
| FFFFSSLSLTLTSHAMAKTPFKLEHPLERRQAEAARIREKYPDRIPVIVEKAERSDIPDIDKKKYLVPADLTAGQFVYVVRKRIKLSAEKAIFVFVKNILPPTAAMMSAIYEENKDEDGF LYMTYSGENTFGSL* | |||
Physicochemical properties | |||
| Number of amino acids: | 134 | ||
| Molecular weight: | 10,929.981 | ||
| Theoretical pI: | 10.595 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10095 | ||
| Instability index: | 41.715 | ||
| aromaticity | 0.101 | ||
| GRAVY | 0.333 | ||
Secondary Structure Fraction | |||
| Helix | 0.323 | ||
| turn | 0.222 | ||
| sheet | 0.323 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341964.1 | 3prime_partial | 99 | 298-2(-) |
Amino Acid sequence : | |||
| MFLTKTKMAFSALSLILLRTTYTNCPAVRSAGTRYFFLSMSGMSLLSAFSTITGILSGYFSLIRAASACRLSRGCSSLKGVLAMAWEVRVKLREEKKKK | |||
Physicochemical properties | |||
| Number of amino acids: | 99 | ||
| Molecular weight: | 10,929.981 | ||
| Theoretical pI: | 10.595 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10095 | ||
| Instability index: | 41.715 | ||
| aromaticity | 0.101 | ||
| GRAVY | 0.333 | ||
Secondary Structure Fraction | |||
| Helix | 0.323 | ||
| turn | 0.222 | ||
| sheet | 0.323 | ||