| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341965.1 | 5prime_partial | 217 | 818-165(-) |
Amino Acid sequence : | |||
| GGKGKRMGASMPKQYLPLLGQPIALYSFYTFSKMPEVKEIVVVCDPSYQDIFEDSKDDIPVNLKFALPGKERQDSVYSGLEAIDSNSKLVCIHDSARPLVLTSDVEKVLKDGKRVGAAVL GVPAKATIKEANSESFVVKTLDRKTLWEMQTPQVIEPDLLKKGFELVNREGLEVTDDVSIVEHLKHPVYITEGSYTNIKVTTPDDLLLAERILNPAD* | |||
Physicochemical properties | |||
| Number of amino acids: | 217 | ||
| Molecular weight: | 14,894.736 | ||
| Theoretical pI: | 8.270 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3355 | ||
| Instability index: | 43.322 | ||
| aromaticity | 0.078 | ||
| GRAVY | 0.174 | ||
Secondary Structure Fraction | |||
| Helix | 0.277 | ||
| turn | 0.348 | ||
| sheet | 0.220 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341965.1 | complete | 141 | 250-675(+) |
Amino Acid sequence : | |||
| MYTGCLRCSTIDTSSVTSSPSLLTSSKPFLSKSGSITCGVCISQRVFLSNVFTTKDSLFASLIVALAGTPSTAAPTRLPSFRTFSTSEVNTRGLAESCMQTSLEFESIASNPLYTESCLS FPGNANFRLTGISSLESSKIS* | |||
Physicochemical properties | |||
| Number of amino acids: | 141 | ||
| Molecular weight: | 14,894.736 | ||
| Theoretical pI: | 8.270 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3355 | ||
| Instability index: | 43.322 | ||
| aromaticity | 0.078 | ||
| GRAVY | 0.174 | ||
Secondary Structure Fraction | |||
| Helix | 0.277 | ||
| turn | 0.348 | ||
| sheet | 0.220 | ||