Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY341965.1 | 5prime_partial | 217 | 818-165(-) |
Amino Acid sequence : | |||
GGKGKRMGASMPKQYLPLLGQPIALYSFYTFSKMPEVKEIVVVCDPSYQDIFEDSKDDIPVNLKFALPGKERQDSVYSGLEAIDSNSKLVCIHDSARPLVLTSDVEKVLKDGKRVGAAVL GVPAKATIKEANSESFVVKTLDRKTLWEMQTPQVIEPDLLKKGFELVNREGLEVTDDVSIVEHLKHPVYITEGSYTNIKVTTPDDLLLAERILNPAD* | |||
Physicochemical properties | |||
Number of amino acids: | 217 | ||
Molecular weight: | 14,894.736 | ||
Theoretical pI: | 8.270 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3355 | ||
Instability index: | 43.322 | ||
aromaticity | 0.078 | ||
GRAVY | 0.174 | ||
Secondary Structure Fraction | |||
Helix | 0.277 | ||
turn | 0.348 | ||
sheet | 0.220 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY341965.1 | complete | 141 | 250-675(+) |
Amino Acid sequence : | |||
MYTGCLRCSTIDTSSVTSSPSLLTSSKPFLSKSGSITCGVCISQRVFLSNVFTTKDSLFASLIVALAGTPSTAAPTRLPSFRTFSTSEVNTRGLAESCMQTSLEFESIASNPLYTESCLS FPGNANFRLTGISSLESSKIS* | |||
Physicochemical properties | |||
Number of amino acids: | 141 | ||
Molecular weight: | 14,894.736 | ||
Theoretical pI: | 8.270 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3355 | ||
Instability index: | 43.322 | ||
aromaticity | 0.078 | ||
GRAVY | 0.174 | ||
Secondary Structure Fraction | |||
Helix | 0.277 | ||
turn | 0.348 | ||
sheet | 0.220 |