| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341970.1 | complete | 127 | 111-494(+) |
Amino Acid sequence : | |||
| MSRRSANCLRFCLVVFAGVSALCVSGPALYFKLKKGFKLEGASPSCPPCICSCAPSQSLFQTVPGLANLSVTDCGEDDPDLKEEMRGGFVDLLSEELKLEEAVSQEHSHHLNITLMEAKR LASLYQR* | |||
Physicochemical properties | |||
| Number of amino acids: | 127 | ||
| Molecular weight: | 13,838.865 | ||
| Theoretical pI: | 5.891 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3480 | ||
| Instability index: | 58.344 | ||
| aromaticity | 0.063 | ||
| GRAVY | 0.002 | ||
Secondary Structure Fraction | |||
| Helix | 0.283 | ||
| turn | 0.252 | ||
| sheet | 0.323 | ||