| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341981.1 | internal | 256 | 1-768(+) |
Amino Acid sequence : | |||
| PLIEAAAIMEHILDGSGYVKAAQKLHEMDPLQKPKQDRYALRTSPQWLGPQIEVIRTATKMIEREINSVNDNPLIDVSRNKALHGGNFQGTPIGVSMDNARLAIASIGKLLFAQFSELVN DFYNNGLPSNLSGGRNPSLDYGFKGAEIAMASYCSELQFLANPVTNHVQSAEQHNQDVNSLGLISSRKTVEALDILKLMSSTYLIALCQAIDLRHLEENLKHAVKNTVSQVAKRTLTMGA NGELHPSRFCEKDLIR | |||
Physicochemical properties | |||
| Number of amino acids: | 256 | ||
| Molecular weight: | 28,219.897 | ||
| Theoretical pI: | 6.835 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 14440 14565 | ||
| Instability index: | 42.786 | ||
| aromaticity | 0.055 | ||
| GRAVY | -0.258 | ||
Secondary Structure Fraction | |||
| Helix | 0.289 | ||
| turn | 0.254 | ||
| sheet | 0.293 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341981.1 | internal | 256 | 1-768(+) |
Amino Acid sequence : | |||
| PLIEAAAIMEHILDGSGYVKAAQKLHEMDPLQKPKQDRYALRTSPQWLGPQIEVIRTATKMIEREINSVNDNPLIDVSRNKALHGGNFQGTPIGVSMDNARLAIASIGKLLFAQFSELVN DFYNNGLPSNLSGGRNPSLDYGFKGAEIAMASYCSELQFLANPVTNHVQSAEQHNQDVNSLGLISSRKTVEALDILKLMSSTYLIALCQAIDLRHLEENLKHAVKNTVSQVAKRTLTMGA NGELHPSRFCEKDLIR | |||
Physicochemical properties | |||
| Number of amino acids: | 256 | ||
| Molecular weight: | 28,219.897 | ||
| Theoretical pI: | 6.835 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 14440 14565 | ||
| Instability index: | 42.786 | ||
| aromaticity | 0.055 | ||
| GRAVY | -0.258 | ||
Secondary Structure Fraction | |||
| Helix | 0.289 | ||
| turn | 0.254 | ||
| sheet | 0.293 | ||