Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY341984.1 | 5prime_partial | 207 | 760-137(-) |
Amino Acid sequence : | |||
RHEASCRIRHEEAIDLRHLEENLKISVKNSVSHVAKKILTTSQNTMLHPSRFCLKELLEVVDREHIFTYIDDPCSFNYPLMQKLRQVLVNHALANVEAEKELAPSIFLKIGEFEEELKAL LPKEVEKVRAEFETKKASIENRIKNCRSYPLYRFVREVAGTDFLTGEKARSPGEEFDKVFTAICEGKLIDPLLDCLKEWNGAPLPIC* | |||
Physicochemical properties | |||
Number of amino acids: | 207 | ||
Molecular weight: | 13,256.781 | ||
Theoretical pI: | 10.658 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 2980 | ||
Instability index: | 53.456 | ||
aromaticity | 0.115 | ||
GRAVY | -0.146 | ||
Secondary Structure Fraction | |||
Helix | 0.279 | ||
turn | 0.377 | ||
sheet | 0.213 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY341984.1 | complete | 122 | 123-491(+) |
Amino Acid sequence : | |||
MIIFHQHIGRGAPFHSLRQSNNGSINFPSQIAVNTLSNSSPGERAFSPVKKSVPATSLTNLYKGYDLQFLILFSMEAFLVSNSARTFSTSLGRRAFNSSSNSPIFKKMEGANSFSASTFA NA* | |||
Physicochemical properties | |||
Number of amino acids: | 122 | ||
Molecular weight: | 13,256.781 | ||
Theoretical pI: | 10.658 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 2980 | ||
Instability index: | 53.456 | ||
aromaticity | 0.115 | ||
GRAVY | -0.146 | ||
Secondary Structure Fraction | |||
Helix | 0.279 | ||
turn | 0.377 | ||
sheet | 0.213 |