Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY341989.1 | complete | 187 | 168-731(+) |
Amino Acid sequence : | |||
MIWSFTTRSSLTRFASCQLRLGLFFHGLHLFRQNQLNVARRRHIRVDSSVSTVCAAPLFLCLVNLNVRNVERIHIQAFHLSIAFSILKQIQDELSRLHRPTALSIGVSVLCLSSSSDTST KSGKWYCLLVGEYILQIPLGLDQRKLSDSVSSLPSVLEVNSEIRSPSLAGIGGIVWLSGVLHHCRCS* | |||
Physicochemical properties | |||
Number of amino acids: | 187 | ||
Molecular weight: | 20,823.658 | ||
Theoretical pI: | 10.116 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 13075 | ||
Instability index: | 49.973 | ||
aromaticity | 0.053 | ||
GRAVY | -0.625 | ||
Secondary Structure Fraction | |||
Helix | 0.246 | ||
turn | 0.241 | ||
sheet | 0.246 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY341989.1 | 5prime_partial | 187 | 755-192(-) |
Amino Acid sequence : | |||
ASLVLPPVSGAATMVKYSREPDNSTNSCKARGSDLRVHFKNTRETAHAIRKLPLIKAKRYLEDVLAHKQAIPFTRFCGGVGRTAQAKNRHSNGQGRWPVKSAKFILDLLKNAESNAEVKG LDVDALYISHIQVNQAQKQRRRTYRAHGRINPYMSSPCHIELILSEKVESVKKEPESQLATSKPGKA* | |||
Physicochemical properties | |||
Number of amino acids: | 187 | ||
Molecular weight: | 20,823.658 | ||
Theoretical pI: | 10.116 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 13075 | ||
Instability index: | 49.973 | ||
aromaticity | 0.053 | ||
GRAVY | -0.625 | ||
Secondary Structure Fraction | |||
Helix | 0.246 | ||
turn | 0.241 | ||
sheet | 0.246 |