Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY341994.1 | complete | 156 | 57-527(+) |
Amino Acid sequence : | |||
MKKKYMSETLDQNSYYSSSSFFLKLRKFLSDNTSFLDFCQHKLKTVKIVEGSPPLLNNQLSAPRAAFPFPLNISSLHSGNKSFLLGNPLDVNLDVGERKPLEVHLAPYHVRGINKCPVLV DDVNDDDELAIILAVVDEGHPTDLNVPLERHFLAEM* | |||
Physicochemical properties | |||
Number of amino acids: | 156 | ||
Molecular weight: | 16,228.101 | ||
Theoretical pI: | 10.213 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15470 | ||
Instability index: | 27.859 | ||
aromaticity | 0.070 | ||
GRAVY | -0.308 | ||
Secondary Structure Fraction | |||
Helix | 0.317 | ||
turn | 0.141 | ||
sheet | 0.261 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY341994.1 | 5prime_partial | 142 | 533-105(-) |
Amino Acid sequence : | |||
THSHLCQKMPFKRYVEIGRVALVNYGKDYGKLVVIVDVIDQNRALVDSPDMVRSQMNFKRLSLTDIKIDIKRVPKKKAFIAAMEAADVKGKWESSSWGRKLIVQKRRAALNDFDRFKLML AKIKKAGVVRQELAKLKKEAAA* | |||
Physicochemical properties | |||
Number of amino acids: | 142 | ||
Molecular weight: | 16,228.101 | ||
Theoretical pI: | 10.213 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15470 | ||
Instability index: | 27.859 | ||
aromaticity | 0.070 | ||
GRAVY | -0.308 | ||
Secondary Structure Fraction | |||
Helix | 0.317 | ||
turn | 0.141 | ||
sheet | 0.261 |