| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341998.1 | 3prime_partial | 203 | 140-748(+) |
Amino Acid sequence : | |||
| MDNTRLAIASIGKLMFAQFSELVNDFYNNGLPSNLSGGRDPSLDYGFKGAEIAMAAYCSELQFLANPVTNHVQSAEQHNQDVNSLGLISSRKTAEAIEILKLMSSTFLVGLCQAIDLRHL EENLKISVKNAVSHVAKKILTTSQNTMLHPSRFCLKELVEVVEREHIFTYIDDPCNFNYPLMQKLRQVLVNHALANGEAEKEV | |||
Physicochemical properties | |||
| Number of amino acids: | 203 | ||
| Molecular weight: | 13,748.863 | ||
| Theoretical pI: | 7.572 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 34490 34865 | ||
| Instability index: | 43.660 | ||
| aromaticity | 0.123 | ||
| GRAVY | 0.272 | ||
Secondary Structure Fraction | |||
| Helix | 0.328 | ||
| turn | 0.230 | ||
| sheet | 0.287 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341998.1 | complete | 122 | 639-271(-) |
Amino Acid sequence : | |||
| MCSLSTTSTNSLRQNLDGWSIVFCDVVRIFLATWLTAFLTEILRFSSKCLKSMAWHSPTKKVEDMSFKISIASAVFLEEMRPNEFTSWLCCSALCTWFVTGLAKNWSSEQYAAMAISAPL NP* | |||
Physicochemical properties | |||
| Number of amino acids: | 122 | ||
| Molecular weight: | 13,748.863 | ||
| Theoretical pI: | 7.572 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 34490 34865 | ||
| Instability index: | 43.660 | ||
| aromaticity | 0.123 | ||
| GRAVY | 0.272 | ||
Secondary Structure Fraction | |||
| Helix | 0.328 | ||
| turn | 0.230 | ||
| sheet | 0.287 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341998.1 | 3prime_partial | 203 | 140-748(+) |
Amino Acid sequence : | |||
| MDNTRLAIASIGKLMFAQFSELVNDFYNNGLPSNLSGGRDPSLDYGFKGAEIAMAAYCSELQFLANPVTNHVQSAEQHNQDVNSLGLISSRKTAEAIEILKLMSSTFLVGLCQAIDLRHL EENLKISVKNAVSHVAKKILTTSQNTMLHPSRFCLKELVEVVEREHIFTYIDDPCNFNYPLMQKLRQVLVNHALANGEAEKEV | |||
Physicochemical properties | |||
| Number of amino acids: | 203 | ||
| Molecular weight: | 13,748.863 | ||
| Theoretical pI: | 7.572 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 34490 34865 | ||
| Instability index: | 43.660 | ||
| aromaticity | 0.123 | ||
| GRAVY | 0.272 | ||
Secondary Structure Fraction | |||
| Helix | 0.328 | ||
| turn | 0.230 | ||
| sheet | 0.287 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341998.1 | complete | 122 | 639-271(-) |
Amino Acid sequence : | |||
| MCSLSTTSTNSLRQNLDGWSIVFCDVVRIFLATWLTAFLTEILRFSSKCLKSMAWHSPTKKVEDMSFKISIASAVFLEEMRPNEFTSWLCCSALCTWFVTGLAKNWSSEQYAAMAISAPL NP* | |||
Physicochemical properties | |||
| Number of amino acids: | 122 | ||
| Molecular weight: | 13,748.863 | ||
| Theoretical pI: | 7.572 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 34490 34865 | ||
| Instability index: | 43.660 | ||
| aromaticity | 0.123 | ||
| GRAVY | 0.272 | ||
Secondary Structure Fraction | |||
| Helix | 0.328 | ||
| turn | 0.230 | ||
| sheet | 0.287 | ||