| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341999.1 | 5prime_partial | 239 | 844-125(-) |
Amino Acid sequence : | |||
| NHVQSAEQHNQDVNSLGLISSRKTAEAIEILKLMSSTFLVGLCQAIDLRHLEENLKISVKNAVSHVAKKILTTSQNTMLHPSRFCLKELVEVVEREHIFTYIDDPCSFNYPLMQKLRQVL VNHALANGEAEKELATSIFLKISEFEEELKALLPKEVDKVRVEFETKKPSIENRIKNCRSYPLYRFVREVAGTDFLTGEKARSPGEEFDEVFTAICEGKLIDPLLDCLKEWNGAPLPIC* | |||
Physicochemical properties | |||
| Number of amino acids: | 239 | ||
| Molecular weight: | 13,252.790 | ||
| Theoretical pI: | 10.658 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 2980 | ||
| Instability index: | 55.286 | ||
| aromaticity | 0.107 | ||
| GRAVY | -0.139 | ||
Secondary Structure Fraction | |||
| Helix | 0.287 | ||
| turn | 0.385 | ||
| sheet | 0.197 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY341999.1 | complete | 122 | 111-479(+) |
Amino Acid sequence : | |||
| MIIFHQHIGRGAPFHSLRQSNNGSINFPSQIAVNTSSNSSPGERAFSPVKKSVPATSLTNLYKGYDLQFLILFSMDGFLVSNSTRTLSTSLGRRAFNSSSNSLIFKKMEVANSFSASPFA NA* | |||
Physicochemical properties | |||
| Number of amino acids: | 122 | ||
| Molecular weight: | 13,252.790 | ||
| Theoretical pI: | 10.658 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 2980 | ||
| Instability index: | 55.286 | ||
| aromaticity | 0.107 | ||
| GRAVY | -0.139 | ||
Secondary Structure Fraction | |||
| Helix | 0.287 | ||
| turn | 0.385 | ||
| sheet | 0.197 | ||