Acc_NO	ORF type	length	start-end position (strand +/-)
>DY342002.1	5prime_partial	212	1-639(+)
Amino Acid sequence :
RLKTQPPHSQPYGHPRPNQPEAPYQGPGSAPQSYGQNMPPPQQSYPYGSSAPMQQSYPPYGATSDGYGHTPAAPAASTYPQAGQQPVAGYTQPGAQQPPPYPQAAPTAGYGSYPATQPGY TEQPAANNTTYGYQAPADPAAAAYGAPQAAPAAYPATAAGQSGYAQPAQAQPSYDQSGGYGNVPAAAGYGKSASPQPAYPQYDSSQMYGAHR*
Physicochemical properties
Number of amino acids:		212
Molecular weight:		21,770.061
Theoretical pI:		6.430
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		37250 37250
Instability index:		71.347
aromaticity		0.118
GRAVY		-0.998
Secondary Structure Fraction
Helix		0.132
turn		0.406
sheet		0.217