| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342018.1 | internal | 208 | 2-625(+) |
Amino Acid sequence : | |||
| YTAGLNPHDRIMGLDLPSGGHLTHGYYTSGGKKISATSIYFESLPYKVDSKTGYIDYERLEEKALDFRPKLIICGGSAYPRDWDYKRFREIADKVGALLLCDMAHISGLVAAQEAADPFE YCDIVTTTTHKSLRGPRAGMIFYRKGPKPPKKGQPEDAVYDFEDKINFAVFPSLPGGPHNHQIGALAVALKQAMSPGFKAYAQQVRAN | |||
Physicochemical properties | |||
| Number of amino acids: | 208 | ||
| Molecular weight: | 22,818.303 | ||
| Theoretical pI: | 8.773 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 20970 21345 | ||
| Instability index: | 40.017 | ||
| aromaticity | 0.048 | ||
| GRAVY | 0.170 | ||
Secondary Structure Fraction | |||
| Helix | 0.346 | ||
| turn | 0.231 | ||
| sheet | 0.260 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342018.1 | internal | 208 | 625-2(-) |
Amino Acid sequence : | |||
| ICTNLLGISLETRGHCLFQGYGKSTNLMVVWASRKRRKHGKVYLVLEIVNGVFWLALLGWLRTLTVEDHASSRTPQALVGCCCDDVAVLERIGCFLSSNESTNMRHITQQQSSNLISDLP KPLIIPIPRVRAPATYNQFRAEIQRLLLQSLVIDVSSLRIHLIRQALEINRGRTDLLPPGCVVSVGEVAAGGQIEAHDAVMGVEAGGV | |||
Physicochemical properties | |||
| Number of amino acids: | 208 | ||
| Molecular weight: | 22,818.303 | ||
| Theoretical pI: | 8.773 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 20970 21345 | ||
| Instability index: | 40.017 | ||
| aromaticity | 0.048 | ||
| GRAVY | 0.170 | ||
Secondary Structure Fraction | |||
| Helix | 0.346 | ||
| turn | 0.231 | ||
| sheet | 0.260 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342018.1 | internal | 208 | 2-625(+) |
Amino Acid sequence : | |||
| YTAGLNPHDRIMGLDLPSGGHLTHGYYTSGGKKISATSIYFESLPYKVDSKTGYIDYERLEEKALDFRPKLIICGGSAYPRDWDYKRFREIADKVGALLLCDMAHISGLVAAQEAADPFE YCDIVTTTTHKSLRGPRAGMIFYRKGPKPPKKGQPEDAVYDFEDKINFAVFPSLPGGPHNHQIGALAVALKQAMSPGFKAYAQQVRAN | |||
Physicochemical properties | |||
| Number of amino acids: | 208 | ||
| Molecular weight: | 22,818.303 | ||
| Theoretical pI: | 8.773 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 20970 21345 | ||
| Instability index: | 40.017 | ||
| aromaticity | 0.048 | ||
| GRAVY | 0.170 | ||
Secondary Structure Fraction | |||
| Helix | 0.346 | ||
| turn | 0.231 | ||
| sheet | 0.260 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342018.1 | internal | 208 | 625-2(-) |
Amino Acid sequence : | |||
| ICTNLLGISLETRGHCLFQGYGKSTNLMVVWASRKRRKHGKVYLVLEIVNGVFWLALLGWLRTLTVEDHASSRTPQALVGCCCDDVAVLERIGCFLSSNESTNMRHITQQQSSNLISDLP KPLIIPIPRVRAPATYNQFRAEIQRLLLQSLVIDVSSLRIHLIRQALEINRGRTDLLPPGCVVSVGEVAAGGQIEAHDAVMGVEAGGV | |||
Physicochemical properties | |||
| Number of amino acids: | 208 | ||
| Molecular weight: | 22,818.303 | ||
| Theoretical pI: | 8.773 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 20970 21345 | ||
| Instability index: | 40.017 | ||
| aromaticity | 0.048 | ||
| GRAVY | 0.170 | ||
Secondary Structure Fraction | |||
| Helix | 0.346 | ||
| turn | 0.231 | ||
| sheet | 0.260 | ||