| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342020.1 | 5prime_partial | 227 | 788-105(-) |
Amino Acid sequence : | |||
| RWSMDEIDRLPDYMKIVLHFVMSAYEEYERDAKKNGKKFASPYFKETIQQLARGYNQELKWVMEKQMPPFKDYLKNSEITSCIYIMFASIIPGLKSFTQEAIDWIKNEPNFAVKAGLIGR YWDDIGSHKRESKGGEMLTVMDCYMKQYSVSIQETISEFAKAVEDSWKEVNEGWVYTISMSKEITVQFLNYSRMCDASYNRNNGDGYTDPSFAKSNITALFVDPIII* | |||
Physicochemical properties | |||
| Number of amino acids: | 227 | ||
| Molecular weight: | 26,471.915 | ||
| Theoretical pI: | 5.400 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 53860 53985 | ||
| Instability index: | 36.811 | ||
| aromaticity | 0.137 | ||
| GRAVY | -0.460 | ||
Secondary Structure Fraction | |||
| Helix | 0.317 | ||
| turn | 0.216 | ||
| sheet | 0.229 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342020.1 | 5prime_partial | 227 | 788-105(-) |
Amino Acid sequence : | |||
| RWSMDEIDRLPDYMKIVLHFVMSAYEEYERDAKKNGKKFASPYFKETIQQLARGYNQELKWVMEKQMPPFKDYLKNSEITSCIYIMFASIIPGLKSFTQEAIDWIKNEPNFAVKAGLIGR YWDDIGSHKRESKGGEMLTVMDCYMKQYSVSIQETISEFAKAVEDSWKEVNEGWVYTISMSKEITVQFLNYSRMCDASYNRNNGDGYTDPSFAKSNITALFVDPIII* | |||
Physicochemical properties | |||
| Number of amino acids: | 227 | ||
| Molecular weight: | 26,471.915 | ||
| Theoretical pI: | 5.400 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 53860 53985 | ||
| Instability index: | 36.811 | ||
| aromaticity | 0.137 | ||
| GRAVY | -0.460 | ||
Secondary Structure Fraction | |||
| Helix | 0.317 | ||
| turn | 0.216 | ||
| sheet | 0.229 | ||