| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342034.1 | 5prime_partial | 123 | 2-373(+) |
Amino Acid sequence : | |||
| SSSSLPFLHTLILSMAKYAAIVLAIMVCVVLAESAPCDNVYKNLAPCRAALKQGSPPTASCCNGMKTLNNAATTKAARKSACQCAKKLATSYKVNGQTASQLVKKCKVNLGYTISGGVDC NKV* | |||
Physicochemical properties | |||
| Number of amino acids: | 123 | ||
| Molecular weight: | 12,803.009 | ||
| Theoretical pI: | 9.507 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5960 6460 | ||
| Instability index: | 32.570 | ||
| aromaticity | 0.041 | ||
| GRAVY | 0.185 | ||
Secondary Structure Fraction | |||
| Helix | 0.252 | ||
| turn | 0.252 | ||
| sheet | 0.276 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342034.1 | 5prime_partial | 123 | 2-373(+) |
Amino Acid sequence : | |||
| SSSSLPFLHTLILSMAKYAAIVLAIMVCVVLAESAPCDNVYKNLAPCRAALKQGSPPTASCCNGMKTLNNAATTKAARKSACQCAKKLATSYKVNGQTASQLVKKCKVNLGYTISGGVDC NKV* | |||
Physicochemical properties | |||
| Number of amino acids: | 123 | ||
| Molecular weight: | 12,803.009 | ||
| Theoretical pI: | 9.507 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5960 6460 | ||
| Instability index: | 32.570 | ||
| aromaticity | 0.041 | ||
| GRAVY | 0.185 | ||
Secondary Structure Fraction | |||
| Helix | 0.252 | ||
| turn | 0.252 | ||
| sheet | 0.276 | ||