| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342036.1 | internal | 247 | 1-741(+) |
Amino Acid sequence : | |||
| PFIAILNLNGRQLFAQPIKVNWAYASGQREDTSSHYNIFVGDLSPEVTDAMLDACFSVYPSCSDARVMWDQKTGRSRGFGFVSFRNQQDAQSAINDLPGKWLGSRQIRCNWATKGAGSSD EKQNSDAKSVVELTSGSSEEVKEATNGDAPENNPQYTTVYVGNLAPEVSQVDLHRHFHALGAGSIEEVRVQRDKGFGFVRYSSHAEAAMAIQLGNAQTYLCGKQIKCSWGNKPTPPGTSS NPLPPPI | |||
Physicochemical properties | |||
| Number of amino acids: | 247 | ||
| Molecular weight: | 11,907.563 | ||
| Theoretical pI: | 10.253 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15470 | ||
| Instability index: | 46.111 | ||
| aromaticity | 0.058 | ||
| GRAVY | 0.491 | ||
Secondary Structure Fraction | |||
| Helix | 0.423 | ||
| turn | 0.154 | ||
| sheet | 0.327 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342036.1 | complete | 104 | 284-598(+) |
Amino Acid sequence : | |||
| MIYLENGWVAGRYAVIGPQKVLVAVMKSRIQMLKVLWNLHLALLKKLRKQQMVMLLRITPSTLLCMLVILLQKYPKLTSIATSMHLVLDQSKKFESSVIKDSVL* | |||
Physicochemical properties | |||
| Number of amino acids: | 104 | ||
| Molecular weight: | 11,907.563 | ||
| Theoretical pI: | 10.253 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15470 | ||
| Instability index: | 46.111 | ||
| aromaticity | 0.058 | ||
| GRAVY | 0.491 | ||
Secondary Structure Fraction | |||
| Helix | 0.423 | ||
| turn | 0.154 | ||
| sheet | 0.327 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342036.1 | internal | 247 | 1-741(+) |
Amino Acid sequence : | |||
| PFIAILNLNGRQLFAQPIKVNWAYASGQREDTSSHYNIFVGDLSPEVTDAMLDACFSVYPSCSDARVMWDQKTGRSRGFGFVSFRNQQDAQSAINDLPGKWLGSRQIRCNWATKGAGSSD EKQNSDAKSVVELTSGSSEEVKEATNGDAPENNPQYTTVYVGNLAPEVSQVDLHRHFHALGAGSIEEVRVQRDKGFGFVRYSSHAEAAMAIQLGNAQTYLCGKQIKCSWGNKPTPPGTSS NPLPPPI | |||
Physicochemical properties | |||
| Number of amino acids: | 247 | ||
| Molecular weight: | 11,907.563 | ||
| Theoretical pI: | 10.253 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15470 | ||
| Instability index: | 46.111 | ||
| aromaticity | 0.058 | ||
| GRAVY | 0.491 | ||
Secondary Structure Fraction | |||
| Helix | 0.423 | ||
| turn | 0.154 | ||
| sheet | 0.327 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342036.1 | complete | 104 | 284-598(+) |
Amino Acid sequence : | |||
| MIYLENGWVAGRYAVIGPQKVLVAVMKSRIQMLKVLWNLHLALLKKLRKQQMVMLLRITPSTLLCMLVILLQKYPKLTSIATSMHLVLDQSKKFESSVIKDSVL* | |||
Physicochemical properties | |||
| Number of amino acids: | 104 | ||
| Molecular weight: | 11,907.563 | ||
| Theoretical pI: | 10.253 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15470 | ||
| Instability index: | 46.111 | ||
| aromaticity | 0.058 | ||
| GRAVY | 0.491 | ||
Secondary Structure Fraction | |||
| Helix | 0.423 | ||
| turn | 0.154 | ||
| sheet | 0.327 | ||