Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY342043.1 | complete | 138 | 243-659(+) |
Amino Acid sequence : | |||
MRLIGAAERGMQLMMQRAVSRRAFDKLIAQHGSFLSDAAKCRVELERTRLLVLEAADQLDRVGNKKARGIIAMAKVAAPSMALKVLDTAMQVHGAAGLSGDTVLAHLWATARTLRIADGP DEVHLGTIAKLELGRARL* | |||
Physicochemical properties | |||
Number of amino acids: | 138 | ||
Molecular weight: | 12,916.005 | ||
Theoretical pI: | 9.341 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16875 | ||
Instability index: | 56.341 | ||
aromaticity | 0.066 | ||
GRAVY | 0.321 | ||
Secondary Structure Fraction | |||
Helix | 0.256 | ||
turn | 0.339 | ||
sheet | 0.298 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY342043.1 | complete | 121 | 484-119(-) |
Amino Acid sequence : | |||
MLGAATLAMAMIPRAFLFPTRSSWSAASRTSNLVLSSSTRHFAASERNEPCWAINLSKALLLTALCIISCIPRSAAPISLMQWCNLPGPSLPCAISNPRPSPSRMFVDGTCTFSNNISAC P* | |||
Physicochemical properties | |||
Number of amino acids: | 121 | ||
Molecular weight: | 12,916.005 | ||
Theoretical pI: | 9.341 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16875 | ||
Instability index: | 56.341 | ||
aromaticity | 0.066 | ||
GRAVY | 0.321 | ||
Secondary Structure Fraction | |||
Helix | 0.256 | ||
turn | 0.339 | ||
sheet | 0.298 |