Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY342050.1 | internal | 250 | 3-752(+) |
Amino Acid sequence : | |||
LSSLQFAASTMLSAVAAEAQNSELSSHALPQTQTSEETADHIFVSKLPSISIPNHLPLHTYCFQNLSQFADRQCLISGNNGKSYSFADTHLICRKVAAGLTKLGIKKGDVIMVLIQNCAE FVFSFIGASMIGAVTTTANPFCTSKEIFKQFNASRSKLIVTQSQYVDKLRDTGDDSVVFGEDFSVVTIDAPPEGCLDFSVLCEADEADAPDVEIDPNDAVALPFSSGTTGLPKGVILTHK SLITSIAQQV | |||
Physicochemical properties | |||
Number of amino acids: | 250 | ||
Molecular weight: | 11,467.314 | ||
Theoretical pI: | 8.797 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7240 | ||
Instability index: | 49.691 | ||
aromaticity | 0.077 | ||
GRAVY | 0.178 | ||
Secondary Structure Fraction | |||
Helix | 0.298 | ||
turn | 0.231 | ||
sheet | 0.240 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY342050.1 | 5prime_partial | 130 | 1-393(+) |
Amino Acid sequence : | |||
LFLLCNSLPQPCCRRWPLKLRIRSSHLMLCPKLKHLKKLQITFLYLSSPPFPSLTISLSTRTVSRISLNSQIANASSPEITENPTPSPTRTSSAGKLPPVSRSSGSKKETLSWCLSRIVP NLSSVSLELQ* | |||
Physicochemical properties | |||
Number of amino acids: | 130 | ||
Molecular weight: | 11,467.314 | ||
Theoretical pI: | 8.797 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7240 | ||
Instability index: | 49.691 | ||
aromaticity | 0.077 | ||
GRAVY | 0.178 | ||
Secondary Structure Fraction | |||
Helix | 0.298 | ||
turn | 0.231 | ||
sheet | 0.240 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY342050.1 | 5prime_partial | 121 | 752-387(-) |
Amino Acid sequence : | |||
DLLRDAGDQALVSQNHSLRQSGGSGGERQRDGVVRINLHVGSVRLVGFAQNREIQAAFRRSVDGNDGEILAEDDGIVACVSELIDVLRLRDDQFGSGGVELLENLLRSTERIRGGGNGAD H* | |||
Physicochemical properties | |||
Number of amino acids: | 121 | ||
Molecular weight: | 11,467.314 | ||
Theoretical pI: | 8.797 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7240 | ||
Instability index: | 49.691 | ||
aromaticity | 0.077 | ||
GRAVY | 0.178 | ||
Secondary Structure Fraction | |||
Helix | 0.298 | ||
turn | 0.231 | ||
sheet | 0.240 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY342050.1 | complete | 104 | 565-251(-) |
Amino Acid sequence : | |||
MVTTEKSSPKTTESSPVSRSLSTYCDCVTINLDLEALNCLKISFEVQKGFAVVVTAPIIEAPMKLKTNSAQFWISTMITSPFLIPSFVRPAATFRQMRCVSAKE* | |||
Physicochemical properties | |||
Number of amino acids: | 104 | ||
Molecular weight: | 11,467.314 | ||
Theoretical pI: | 8.797 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7240 | ||
Instability index: | 49.691 | ||
aromaticity | 0.077 | ||
GRAVY | 0.178 | ||
Secondary Structure Fraction | |||
Helix | 0.298 | ||
turn | 0.231 | ||
sheet | 0.240 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY342050.1 | internal | 250 | 3-752(+) |
Amino Acid sequence : | |||
LSSLQFAASTMLSAVAAEAQNSELSSHALPQTQTSEETADHIFVSKLPSISIPNHLPLHTYCFQNLSQFADRQCLISGNNGKSYSFADTHLICRKVAAGLTKLGIKKGDVIMVLIQNCAE FVFSFIGASMIGAVTTTANPFCTSKEIFKQFNASRSKLIVTQSQYVDKLRDTGDDSVVFGEDFSVVTIDAPPEGCLDFSVLCEADEADAPDVEIDPNDAVALPFSSGTTGLPKGVILTHK SLITSIAQQV | |||
Physicochemical properties | |||
Number of amino acids: | 250 | ||
Molecular weight: | 11,467.314 | ||
Theoretical pI: | 8.797 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7240 | ||
Instability index: | 49.691 | ||
aromaticity | 0.077 | ||
GRAVY | 0.178 | ||
Secondary Structure Fraction | |||
Helix | 0.298 | ||
turn | 0.231 | ||
sheet | 0.240 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY342050.1 | 5prime_partial | 130 | 1-393(+) |
Amino Acid sequence : | |||
LFLLCNSLPQPCCRRWPLKLRIRSSHLMLCPKLKHLKKLQITFLYLSSPPFPSLTISLSTRTVSRISLNSQIANASSPEITENPTPSPTRTSSAGKLPPVSRSSGSKKETLSWCLSRIVP NLSSVSLELQ* | |||
Physicochemical properties | |||
Number of amino acids: | 130 | ||
Molecular weight: | 11,467.314 | ||
Theoretical pI: | 8.797 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7240 | ||
Instability index: | 49.691 | ||
aromaticity | 0.077 | ||
GRAVY | 0.178 | ||
Secondary Structure Fraction | |||
Helix | 0.298 | ||
turn | 0.231 | ||
sheet | 0.240 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY342050.1 | 5prime_partial | 121 | 752-387(-) |
Amino Acid sequence : | |||
DLLRDAGDQALVSQNHSLRQSGGSGGERQRDGVVRINLHVGSVRLVGFAQNREIQAAFRRSVDGNDGEILAEDDGIVACVSELIDVLRLRDDQFGSGGVELLENLLRSTERIRGGGNGAD H* | |||
Physicochemical properties | |||
Number of amino acids: | 121 | ||
Molecular weight: | 11,467.314 | ||
Theoretical pI: | 8.797 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7240 | ||
Instability index: | 49.691 | ||
aromaticity | 0.077 | ||
GRAVY | 0.178 | ||
Secondary Structure Fraction | |||
Helix | 0.298 | ||
turn | 0.231 | ||
sheet | 0.240 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY342050.1 | complete | 104 | 565-251(-) |
Amino Acid sequence : | |||
MVTTEKSSPKTTESSPVSRSLSTYCDCVTINLDLEALNCLKISFEVQKGFAVVVTAPIIEAPMKLKTNSAQFWISTMITSPFLIPSFVRPAATFRQMRCVSAKE* | |||
Physicochemical properties | |||
Number of amino acids: | 104 | ||
Molecular weight: | 11,467.314 | ||
Theoretical pI: | 8.797 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7240 | ||
Instability index: | 49.691 | ||
aromaticity | 0.077 | ||
GRAVY | 0.178 | ||
Secondary Structure Fraction | |||
Helix | 0.298 | ||
turn | 0.231 | ||
sheet | 0.240 |