| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342063.1 | internal | 260 | 3-782(+) |
Amino Acid sequence : | |||
| FKNPNLYLKADDVPLRVLPLFHIYSLNSVLLCSLRAGAGVLLMQKFEIGSLLELIQKHRVSVAAVVPPLVLALAKNPLVDNFDLSSIRLVLSGAAPLGKELEAALLTRLPQAIFGQGYGM TEAGPVLSMSPSFAKQPLPTKSGSCGNVVRNAELKVIDPETGCSLPRTQPGEICIRGPQIMKGYLNDAEATARTIDVDGWLHTGDIGFVDEDDDIFIVDRVKELIKFKGFQVPPPELEAL LISHSQISDAAVVTPKKMRL | |||
Physicochemical properties | |||
| Number of amino acids: | 260 | ||
| Molecular weight: | 14,113.973 | ||
| Theoretical pI: | 6.637 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 27960 28085 | ||
| Instability index: | 32.224 | ||
| aromaticity | 0.131 | ||
| GRAVY | -0.223 | ||
Secondary Structure Fraction | |||
| Helix | 0.352 | ||
| turn | 0.221 | ||
| sheet | 0.205 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342063.1 | complete | 203 | 676-65(-) |
Amino Acid sequence : | |||
| MSSFTLSTMKMSSSSSTNPISPVCSQPSTSMVLAVASASFKYPFMIWGPRMQISPGWVRGREQPVSGSMTLSSALRTTLPHDPDLVGSGCFANDGDIDSTGPASVMPYPCPKMACGRRVS RAASSSLPSGAAPDKTSLMELKSKLSTKGFLASASTSGGTTAATDTRCFCISSNSDPISNFCINRTPAPALSEHSNTEFNEYM* | |||
Physicochemical properties | |||
| Number of amino acids: | 203 | ||
| Molecular weight: | 14,113.973 | ||
| Theoretical pI: | 6.637 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 27960 28085 | ||
| Instability index: | 32.224 | ||
| aromaticity | 0.131 | ||
| GRAVY | -0.223 | ||
Secondary Structure Fraction | |||
| Helix | 0.352 | ||
| turn | 0.221 | ||
| sheet | 0.205 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342063.1 | 5prime_partial | 122 | 782-414(-) |
Amino Acid sequence : | |||
| QPHLFWGNNGRIRDLRMGDEKSLQFRWWYLKAFEFDELLHPVYNENVIVFIHKPYIPCMQPTIHVYGSRRCLSIIQVPFHDLGSTDANFTGLGAGQGATCFRVDDLELGIADHIATRPRL GW* | |||
Physicochemical properties | |||
| Number of amino acids: | 122 | ||
| Molecular weight: | 14,113.973 | ||
| Theoretical pI: | 6.637 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 27960 28085 | ||
| Instability index: | 32.224 | ||
| aromaticity | 0.131 | ||
| GRAVY | -0.223 | ||
Secondary Structure Fraction | |||
| Helix | 0.352 | ||
| turn | 0.221 | ||
| sheet | 0.205 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342063.1 | internal | 260 | 3-782(+) |
Amino Acid sequence : | |||
| FKNPNLYLKADDVPLRVLPLFHIYSLNSVLLCSLRAGAGVLLMQKFEIGSLLELIQKHRVSVAAVVPPLVLALAKNPLVDNFDLSSIRLVLSGAAPLGKELEAALLTRLPQAIFGQGYGM TEAGPVLSMSPSFAKQPLPTKSGSCGNVVRNAELKVIDPETGCSLPRTQPGEICIRGPQIMKGYLNDAEATARTIDVDGWLHTGDIGFVDEDDDIFIVDRVKELIKFKGFQVPPPELEAL LISHSQISDAAVVTPKKMRL | |||
Physicochemical properties | |||
| Number of amino acids: | 260 | ||
| Molecular weight: | 14,113.973 | ||
| Theoretical pI: | 6.637 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 27960 28085 | ||
| Instability index: | 32.224 | ||
| aromaticity | 0.131 | ||
| GRAVY | -0.223 | ||
Secondary Structure Fraction | |||
| Helix | 0.352 | ||
| turn | 0.221 | ||
| sheet | 0.205 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342063.1 | complete | 203 | 676-65(-) |
Amino Acid sequence : | |||
| MSSFTLSTMKMSSSSSTNPISPVCSQPSTSMVLAVASASFKYPFMIWGPRMQISPGWVRGREQPVSGSMTLSSALRTTLPHDPDLVGSGCFANDGDIDSTGPASVMPYPCPKMACGRRVS RAASSSLPSGAAPDKTSLMELKSKLSTKGFLASASTSGGTTAATDTRCFCISSNSDPISNFCINRTPAPALSEHSNTEFNEYM* | |||
Physicochemical properties | |||
| Number of amino acids: | 203 | ||
| Molecular weight: | 14,113.973 | ||
| Theoretical pI: | 6.637 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 27960 28085 | ||
| Instability index: | 32.224 | ||
| aromaticity | 0.131 | ||
| GRAVY | -0.223 | ||
Secondary Structure Fraction | |||
| Helix | 0.352 | ||
| turn | 0.221 | ||
| sheet | 0.205 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342063.1 | 5prime_partial | 122 | 782-414(-) |
Amino Acid sequence : | |||
| QPHLFWGNNGRIRDLRMGDEKSLQFRWWYLKAFEFDELLHPVYNENVIVFIHKPYIPCMQPTIHVYGSRRCLSIIQVPFHDLGSTDANFTGLGAGQGATCFRVDDLELGIADHIATRPRL GW* | |||
Physicochemical properties | |||
| Number of amino acids: | 122 | ||
| Molecular weight: | 14,113.973 | ||
| Theoretical pI: | 6.637 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 27960 28085 | ||
| Instability index: | 32.224 | ||
| aromaticity | 0.131 | ||
| GRAVY | -0.223 | ||
Secondary Structure Fraction | |||
| Helix | 0.352 | ||
| turn | 0.221 | ||
| sheet | 0.205 | ||