| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342064.1 | internal | 146 | 1-438(+) |
Amino Acid sequence : | |||
| FTGWKLGNGMDKQHFWHPLGKHNPFGNEFLDTFFTKFRSCCRDYQSHGNFTSSLIFLRYNGRIKDLRMGNEKNLQLNWWYLKAFEFDELLHPVYNENVIVFIHKPYIPCMQPTIHVYGSP RCLTIIQVPFHDLGSTDANFTRLGAG | |||
Physicochemical properties | |||
| Number of amino acids: | 146 | ||
| Molecular weight: | 15,993.187 | ||
| Theoretical pI: | 4.937 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7115 | ||
| Instability index: | 29.253 | ||
| aromaticity | 0.089 | ||
| GRAVY | 0.030 | ||
Secondary Structure Fraction | |||
| Helix | 0.349 | ||
| turn | 0.219 | ||
| sheet | 0.199 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342064.1 | internal | 146 | 438-1(-) |
Amino Acid sequence : | |||
| PRTQPGEICIRGPQIMKGYLNDGEATGRTIDVDGWLHTGDIGFVDEDDDIFIVDRVKELIKFKGFQVPPVELEVLFISHSQIFDAAVVPQKDEAAGEVPVALVVPAAGSEFSEECVKEFI SKRVVFSKGVPKVLFVHAIPKFPSGK | |||
Physicochemical properties | |||
| Number of amino acids: | 146 | ||
| Molecular weight: | 15,993.187 | ||
| Theoretical pI: | 4.937 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7115 | ||
| Instability index: | 29.253 | ||
| aromaticity | 0.089 | ||
| GRAVY | 0.030 | ||
Secondary Structure Fraction | |||
| Helix | 0.349 | ||
| turn | 0.219 | ||
| sheet | 0.199 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342064.1 | internal | 146 | 1-438(+) |
Amino Acid sequence : | |||
| FTGWKLGNGMDKQHFWHPLGKHNPFGNEFLDTFFTKFRSCCRDYQSHGNFTSSLIFLRYNGRIKDLRMGNEKNLQLNWWYLKAFEFDELLHPVYNENVIVFIHKPYIPCMQPTIHVYGSP RCLTIIQVPFHDLGSTDANFTRLGAG | |||
Physicochemical properties | |||
| Number of amino acids: | 146 | ||
| Molecular weight: | 15,993.187 | ||
| Theoretical pI: | 4.937 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7115 | ||
| Instability index: | 29.253 | ||
| aromaticity | 0.089 | ||
| GRAVY | 0.030 | ||
Secondary Structure Fraction | |||
| Helix | 0.349 | ||
| turn | 0.219 | ||
| sheet | 0.199 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342064.1 | internal | 146 | 438-1(-) |
Amino Acid sequence : | |||
| PRTQPGEICIRGPQIMKGYLNDGEATGRTIDVDGWLHTGDIGFVDEDDDIFIVDRVKELIKFKGFQVPPVELEVLFISHSQIFDAAVVPQKDEAAGEVPVALVVPAAGSEFSEECVKEFI SKRVVFSKGVPKVLFVHAIPKFPSGK | |||
Physicochemical properties | |||
| Number of amino acids: | 146 | ||
| Molecular weight: | 15,993.187 | ||
| Theoretical pI: | 4.937 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7115 | ||
| Instability index: | 29.253 | ||
| aromaticity | 0.089 | ||
| GRAVY | 0.030 | ||
Secondary Structure Fraction | |||
| Helix | 0.349 | ||
| turn | 0.219 | ||
| sheet | 0.199 | ||