| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342089.1 | complete | 144 | 558-124(-) |
Amino Acid sequence : | |||
| MYYANFISSPEGYFHTVSCNWPEFSNTTVNTDLHFISWDNPPKQHPHYLTVEDMQRMVDSNAPFARKFHHDDPVLDRIDEELLSRGKGMLVPGGWCAGSSENGTDPCSVVGNVTDFRPTG GGKRLENLTRLLLSENNFRRKQCK* | |||
Physicochemical properties | |||
| Number of amino acids: | 144 | ||
| Molecular weight: | 11,354.324 | ||
| Theoretical pI: | 10.440 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1740 | ||
| Instability index: | 56.445 | ||
| aromaticity | 0.010 | ||
| GRAVY | -0.399 | ||
Secondary Structure Fraction | |||
| Helix | 0.255 | ||
| turn | 0.265 | ||
| sheet | 0.225 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342089.1 | 3prime_partial | 125 | 377-3(-) |
Amino Acid sequence : | |||
| MPHLPESSTTMTPCWIESTRSFCLVAKACSSPAAGAQAVVKTGPTLVPLWAMLRISGLPVAGKDSKILRGCFYRRTTFDGSSASSKRRQPFCLWCHFYGRKGRKGESDQIHKSIYHKRYT CFIFQ | |||
Physicochemical properties | |||
| Number of amino acids: | 125 | ||
| Molecular weight: | 11,354.324 | ||
| Theoretical pI: | 10.440 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1740 | ||
| Instability index: | 56.445 | ||
| aromaticity | 0.010 | ||
| GRAVY | -0.399 | ||
Secondary Structure Fraction | |||
| Helix | 0.255 | ||
| turn | 0.265 | ||
| sheet | 0.225 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342089.1 | complete | 103 | 107-418(+) |
Amino Acid sequence : | |||
| MAVYVCYLHCFRRKLFSDKSSLVRFSSLFPPPVGLKSVTLPTTEQGSVPFSLLPAHQPPGTSMPLPRDKSSSSILSSTGSSWWNFLANGALLSTILCMSSTVR* | |||
Physicochemical properties | |||
| Number of amino acids: | 103 | ||
| Molecular weight: | 11,354.324 | ||
| Theoretical pI: | 10.440 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1740 | ||
| Instability index: | 56.445 | ||
| aromaticity | 0.010 | ||
| GRAVY | -0.399 | ||
Secondary Structure Fraction | |||
| Helix | 0.255 | ||
| turn | 0.265 | ||
| sheet | 0.225 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342089.1 | 5prime_partial | 102 | 652-344(-) |
Amino Acid sequence : | |||
| TRVYRLCLDGTLLIIGRLLHMGMGQPTSNSPHVLCQLHILPRGLLPHRKLQLAGIQQHHRQHRPPLHILGQPPEAAPPLPHCGRHAKDGGQQCPICQKVPPR* | |||
Physicochemical properties | |||
| Number of amino acids: | 102 | ||
| Molecular weight: | 11,354.324 | ||
| Theoretical pI: | 10.440 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1740 | ||
| Instability index: | 56.445 | ||
| aromaticity | 0.010 | ||
| GRAVY | -0.399 | ||
Secondary Structure Fraction | |||
| Helix | 0.255 | ||
| turn | 0.265 | ||
| sheet | 0.225 | ||