Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY342093.1 | 5prime_partial | 172 | 3-521(+) |
Amino Acid sequence : | |||
KYLDAKTIFHLNPSGRFVIGGPHGDAGLTGRKIIIDTYGGWGAHGGGAFSGKDPTKVDRSGAYIVRQAAKSIVASGMARRCIVQVSYAIGVPEPLSVFVDSYGTGKIPDKEILKIVKENF DFRPGMISINLDLKRGGNGRFLKTAAYGHFGRDDADFTWEVVKPLKWDKPQA* | |||
Physicochemical properties | |||
Number of amino acids: | 172 | ||
Molecular weight: | 18,654.151 | ||
Theoretical pI: | 9.618 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 25440 25440 | ||
Instability index: | 10.219 | ||
aromaticity | 0.105 | ||
GRAVY | -0.248 | ||
Secondary Structure Fraction | |||
Helix | 0.308 | ||
turn | 0.267 | ||
sheet | 0.169 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY342093.1 | 5prime_partial | 172 | 3-521(+) |
Amino Acid sequence : | |||
KYLDAKTIFHLNPSGRFVIGGPHGDAGLTGRKIIIDTYGGWGAHGGGAFSGKDPTKVDRSGAYIVRQAAKSIVASGMARRCIVQVSYAIGVPEPLSVFVDSYGTGKIPDKEILKIVKENF DFRPGMISINLDLKRGGNGRFLKTAAYGHFGRDDADFTWEVVKPLKWDKPQA* | |||
Physicochemical properties | |||
Number of amino acids: | 172 | ||
Molecular weight: | 18,654.151 | ||
Theoretical pI: | 9.618 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 25440 25440 | ||
Instability index: | 10.219 | ||
aromaticity | 0.105 | ||
GRAVY | -0.248 | ||
Secondary Structure Fraction | |||
Helix | 0.308 | ||
turn | 0.267 | ||
sheet | 0.169 |