| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342095.1 | internal | 261 | 3-785(+) |
Amino Acid sequence : | |||
| LGSATNTPQINSDEEENFLFAMQLASASVLPMVLKSAIELDLLELIKKSGAGAFVSPVDLAAQLPTTNPHAHVMLDRILRLLTSYAILECRLKTLPDGGVERLYGLAPVCKFLTKNEDGV SMAPLTLMNQDKVLMESWYHLKDAVLDGGIPFNKAYGMTAFEYHGTDPRFNKVFNQGMSNHSTITMKKILETYTGFDGLKTVVDVGGGTGATLNMIVSKYPSIKGINFDLPHVIEDAPSY PGVEHVGGDMFVSVPKGDAIF | |||
Physicochemical properties | |||
| Number of amino acids: | 261 | ||
| Molecular weight: | 28,326.344 | ||
| Theoretical pI: | 5.335 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 17420 17545 | ||
| Instability index: | 29.579 | ||
| aromaticity | 0.080 | ||
| GRAVY | 0.049 | ||
Secondary Structure Fraction | |||
| Helix | 0.322 | ||
| turn | 0.253 | ||
| sheet | 0.280 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY342095.1 | internal | 261 | 3-785(+) |
Amino Acid sequence : | |||
| LGSATNTPQINSDEEENFLFAMQLASASVLPMVLKSAIELDLLELIKKSGAGAFVSPVDLAAQLPTTNPHAHVMLDRILRLLTSYAILECRLKTLPDGGVERLYGLAPVCKFLTKNEDGV SMAPLTLMNQDKVLMESWYHLKDAVLDGGIPFNKAYGMTAFEYHGTDPRFNKVFNQGMSNHSTITMKKILETYTGFDGLKTVVDVGGGTGATLNMIVSKYPSIKGINFDLPHVIEDAPSY PGVEHVGGDMFVSVPKGDAIF | |||
Physicochemical properties | |||
| Number of amino acids: | 261 | ||
| Molecular weight: | 28,326.344 | ||
| Theoretical pI: | 5.335 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 17420 17545 | ||
| Instability index: | 29.579 | ||
| aromaticity | 0.080 | ||
| GRAVY | 0.049 | ||
Secondary Structure Fraction | |||
| Helix | 0.322 | ||
| turn | 0.253 | ||
| sheet | 0.280 | ||