Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY342101.1 | 5prime_partial | 131 | 3-398(+) |
Amino Acid sequence : | |||
LSQTMADSKNLPYHSEEQKNPFVIFFTNLLSSIKLPFPPKKNGANSEPAAANPPAAVDDETKPALVKLPRQSFEPIKLEVEADEAGQNTNPLILWQVYALGGVLVLRWAWMKWNERKGQK KSDNDPSPAHD* | |||
Physicochemical properties | |||
Number of amino acids: | 131 | ||
Molecular weight: | 14,620.394 | ||
Theoretical pI: | 6.160 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 24980 24980 | ||
Instability index: | 51.922 | ||
aromaticity | 0.084 | ||
GRAVY | -0.621 | ||
Secondary Structure Fraction | |||
Helix | 0.267 | ||
turn | 0.290 | ||
sheet | 0.282 |