Acc_NO	ORF type	length	start-end position (strand +/-)
>DY342101.1	5prime_partial	131	3-398(+)
Amino Acid sequence :
LSQTMADSKNLPYHSEEQKNPFVIFFTNLLSSIKLPFPPKKNGANSEPAAANPPAAVDDETKPALVKLPRQSFEPIKLEVEADEAGQNTNPLILWQVYALGGVLVLRWAWMKWNERKGQK KSDNDPSPAHD*
Physicochemical properties
Number of amino acids:		131
Molecular weight:		14,620.394
Theoretical pI:		6.160
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		24980 24980
Instability index:		51.922
aromaticity		0.084
GRAVY		-0.621
Secondary Structure Fraction
Helix		0.267
turn		0.290
sheet		0.282