Acc_NO	ORF type	length	start-end position (strand +/-)
>DY342102.1	complete	134	81-485(+)
Amino Acid sequence :
MIICNHNHPFYQHDDANHEPGTDRYPTFSGLSSHSISSMPISETRTPPKAYTCHKIKGLVFCPASSASTSNLIGSKLWRGNFTKAGLVSSSTAAGGLAAAGSELTPFFLGGKGNLIEESK FVKKITKGFFCSSD*
Physicochemical properties
Number of amino acids:		134
Molecular weight:		12,402.940
Theoretical pI:		4.514
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		8480 8480
Instability index:		49.427
aromaticity		0.071
GRAVY		-0.368
Secondary Structure Fraction
Helix		0.274
turn		0.292
sheet		0.319

Acc_NO	ORF type	length	start-end position (strand +/-)
>DY342102.1	5prime_partial	113	520-179(-)
Amino Acid sequence :
SQTMADSKNLPYQSEEQKNPFVIFFTNLLSSIKLPFPPKKNGVNSEPAAANPPAAVDDETKPALVKLPRQSFEPIKLEVEADEAGQNTNPLILWQVYALGGVLVSEMGMDEME*
Physicochemical properties
Number of amino acids:		113
Molecular weight:		12,402.940
Theoretical pI:		4.514
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		8480 8480
Instability index:		49.427
aromaticity		0.071
GRAVY		-0.368
Secondary Structure Fraction
Helix		0.274
turn		0.292
sheet		0.319